KEGG   Anser cygnoides domesticus (swan goose): 106041076Help
Entry
106041076         CDS       T04896                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00512  Mucin type O-glycan biosynthesis
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    106041076 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acyg01003]
    106041076 (WBSCR17)
Enzymes [BR:acyg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     106041076 (WBSCR17)
Glycosyltransferases [BR:acyg01003]
 O-Glycan biosynthesis
  Mucin-type
   106041076 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 106041076
NCBI-ProteinID: XP_013044771
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDVHPRAEVVNLTAHGIGSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLD
CEKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgcggagagtcaaagtcctgctggtgttaaacctgatcgcggtggctggc
ttcgtcctcttcctggccaagtgcagacccatcacggccaagagcggcgactctttccac
gacgtccatcccagggcagaagtggtcaacttgacagcccacggcatcggctccatccag
gatgcggtgctgaagaggctctccctcctggaagacatagtctacaggcagctcaatggt
ctgtccaagtcacttggtctcattgaaggctatggtggacgtggcaaaggtgggcttcca
gccaccctgtcccccgaggaggaggagaaagctaagggaccccatgagaaatacggctac
aactcctacctcagtgagaaaatttcactggatcgttccataccagattatcgtccaacc
aagtgcaaagagctgaaatacggtaaggacctaccccagatctccattatcttcatcttc
gtgaatgaagcgctgtcggttatcctgcggtcggtgcacagcgctgttaatcatacacca
gctcacctgctgaaggagattatccttgtggatgacaacagtgatgaagaggaactgaag
gcgccgctggaggagtatgtcaacaaacgatacccggggctggtgaaggtggtgcgcaac
cagaagagggaaggccttatccgcgcacgcatcgagggctggaaggctgccacaggccag
gtcactggattttttgatgcccacgtggagttcactgctggctgggctgagccagtactc
tcgcgaattcaggagaatcgaagaagggtcattcttccctccatcgacaacatcaagcag
gacaactttgaggtgcagcgctacgagaactctgcccacgggtacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggacgctggggacccctcgctgcccatc
aggacaccagcgatgattggttgctcctttgttgtgcacaggaagttctttggagagatt
gggctcctcgatcctgggatggatgtgtatggaggagagaacatagagctcggcatcaag
gtgtggctctgcggtggcagcatggaggtcctgccctgctccagggtggctcacatcgag
cgcaagaagaagccctacaacaacaacatcggtttctacaccaagcgcaatgccctgcga
gtggccgaggtgtggatggatgactacaagtcccatgtctacatcgcatggaacttgccg
ctggagaatccaggtattgacattggggatgtctctgagagaaaagctttgaggaagagc
ttgaagtgtaaaaatttccagtggtatctggaccacgtttatccagaaatgagaagatac
aacaacaccatcgcgtatggcgagcttcgaaacaacaaagcgaaggatgtttgccttgac
cagggcccgcaggagaaccacacagcaatattgtacccgtgccacggctggggaccgcag
cttgcacgctacaccaaggaggggttccttcatctcggcgccctcgggaccacgactctt
ctgcccgacacccgctgcctggtggataatgtgaaaagccgcttccctcagctcctcgac
tgcgaaaaggtcaagagcagcctccataagcgctggaatttcatccagaatggtgccatc
ttgaacaagggaacggggcgctgcttggaagtggagaacagaggaatggctggcatcgat
ctgattcttcgcagctgcacaggacaaaggtggacaattaaaaatttcatcaagtaa

DBGET integrated database retrieval system