KEGG   Anser cygnoides domesticus (swan goose): 106041446Help
Entry
106041446         CDS       T04896                                 

Gene name
LIG3
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    106041446 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acyg03400]
    106041446 (LIG3)
Enzymes [BR:acyg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106041446 (LIG3)
DNA repair and recombination proteins [BR:acyg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     106041446 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 106041446
NCBI-ProteinID: XP_013045332
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MAEQRYCVDYAKRGTAGCKKCKEKLVKGTVRIGKIVPNPFTESGGEMKEWYHVRCMFEKL
EKARATTKKIEDITDLEGWEELQDEEKELIHKHIAEATTKAASTPKKKATVQAKLTPTGQ
ITSPSKDPLAAVNPKKFSGFTAKPKNSEDVPANSSHKSSLSAKKSDPKHKDCLLREFRKL
CAMVADKPSYNVKTQIIQDFLKKGTGGDGFHGDVYLTIKLLLPGVIKIVYNLNDKQIVKL
FSRIFNCSQEEMIRDLEQGDVSETIRLFFEQSKSCPPAAKSLLTIQEVDEFLIQLSKLTK
EDDQQSVLHDITRRCTGNDLKCIIRLIKHDLKMNAGAKHVLDALDPNAYEAFKASRNLQD
VVERVLKNQQEAEKMPGLKRTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEIKY
DGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDFIPQAFPGGHSMILDSEVLLIDNKTG
KPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDISLMDRPLRERRKFLHDNMVEIPXPDP
LLRDEACLKSFGSGRYDHRVIREGLEGLVLKDIKGNYEPGKRHWLKVKKDYLNEGAMADT
ADLVVLGAFYGQGSKGGMMSIFLMGCYDPKSEKWCTVTKCAGGHDDATLARLQTELDMVK
ISKDPSKIPSWLKINKIYYPDFIVPDPKKAPVWEITGAEFSKAEAHTADGISIRFPRCTR
IRDDKDWKTATNLPQLKELYQLSKEKADFSVVAGEEEESTAGSSGENEGNSRSSTPHKTT
KTPPSKSPAKAKKPEGTKAITESPQKPEEKRGEKRKASEMDDNGKKTLLDIFTGVKLYLS
PSVKDFNKIRRYFIAYDGDLVPEFDTASATHVIGDIDENPGAKRVSPNWIWECIRKRRLV
APC
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagcggtactgcgtggactacgccaagcgcggcacggccggctgcaagaag
tgcaaggagaagctggtgaagggcacggtgcgcatcgggaagatcgtgcccaaccccttc
accgagtccggcggggagatgaaggagtggtaccacgtcaggtgcatgtttgagaagctg
gagaaggcccgcgccaccaccaagaagatcgaggacatcacggacttggagggctgggag
gagctgcaggacgaggagaaggagctaatccacaagcacatcgcagaagctactaccaag
gctgcaagtacgccaaagaaaaaagcaacagtccaagctaagctcactcccacaggacaa
ataaccagtccctcaaaggatccgttagctgctgtcaatccgaagaagttctctggcttc
acagccaagccaaagaattcagaagatgttcctgcaaactcttcccacaagtctagtctg
tctgcaaaaaaaagtgatccgaagcacaaagactgcttgctgcgagagttcaggaagctc
tgcgccatggttgccgacaagcccagctataatgtgaaaacgcagatcatccaggacttc
ctgaagaagggaactggaggagatggttttcatggtgacgtatacctgaccattaagctg
ctgttaccaggcgtcattaaaattgtttacaacttgaacgataagcagattgtaaagctg
tttagtaggatttttaactgcagccaagaggaaatgatccgggacctggaacagggagat
gtctccgagaccatacgcctcttctttgaacagagcaagtcttgtcctccggcagctaaa
agtctcctgaccatccaagaggtagatgagttcctaatccagctatcaaagcttactaag
gaagatgaccagcaaagtgtgctgcacgatatcactcgcagatgtacgggcaacgacctg
aaatgcatcatcaggctaattaagcatgacctgaaaatgaatgctggtgcaaagcatgtg
ctggatgctttggatccaaatgcttatgaggcattcaaagcgtcacgcaacctccaggat
gtggtagagcgagtcctgaagaaccagcaggaggccgagaagatgccagggctgaagcga
accctcagcgtgcaggcctccctgatgaccccagtgcagcccatgctggctgaagcctgc
aagtcaattgagtatgccatgaagaagtgcccaaatggcatgtatgcggagatcaaatac
gatggtgagcgagtgcaggtccataaaaatggagatcacttcagctacttcagccggagc
ctcaaacctgtccttcctcacaaagtagcacattttaaggacttcatcccccaggctttc
cctggcgggcacagtatgatcctggattcggaagttcttctaattgataacaaaactggc
aagccacttccttttgggactcttggtgtgcataagaaagctgctttccaagacgccaat
gtttgcttgtttgtgtttgactgcatctatttcaatgacatcagcctgatggacaggcct
ctgcgcgagcgtcgcaagtttctacatgataacatggttgaaatccccnaaccggatcct
cttctcagagatgaagcatgtctcaaaagcttcggatctggcagatatgatcaccgagtc
atccgtgaaggactggaaggactggtgttgaaagatataaagggtaattatgaaccagga
aaacggcactggctgaaagtgaaaaaggactacttaaatgagggtgcaatggctgacaca
gcagacttggtggtgctgggagctttctatgggcaaggcagtaaaggtgggatgatgtcc
attttcctcatgggctgctatgatcccaagagtgagaagtggtgtactgtgaccaagtgt
gctggtggccatgacgatgccaccttggcccgtctgcaaacagagctggatatggtgaag
atcagcaaggatcccagtaaaattccaagctggctaaaaattaacaaaatctactaccca
gacttcattgtcccagatccaaagaaagccccagtatgggagatcacaggagctgaattc
tctaaagcagaagcccacactgcagatgggatctccattcgcttccctcgctgcacccgc
attcgagatgacaaggactggaagacagccaccaacctcccgcagcttaaggagctgtac
caactctccaaagaaaaggctgacttcagtgttgttgctggggaggaagaagagtccacg
gctggcagcagtggagagaatgagggaaattccaggtcttccacgccacacaagactact
aaaactcccccaagcaagtcacctgcaaaagccaagaagccagaaggcactaaagcaatc
actgaatcccctcaaaagccagaggagaaacgaggagagaagcgaaaagcatctgagatg
gatgacaatggaaagaagacactgctggacatattcactggtgtgaagctgtacctatcg
ccctccgtgaaggatttcaacaaaatccgtcgctacttcatagcatacgatggtgatctt
gtgccagagtttgacacagcctcagcaacgcatgttataggggacattgatgagaatcct
ggtgctaagcgtgtatctccaaactggatctgggaatgcatacgcaaacggagactggta
gccccatgctag

DBGET integrated database retrieval system