KEGG   Anser cygnoides domesticus (swan goose): 106043795
Entry
106043795         CDS       T04896                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00220  Arginine biosynthesis
acyg00330  Arginine and proline metabolism
acyg01100  Metabolic pathways
acyg04020  Calcium signaling pathway
acyg04146  Peroxisome
acyg04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106043795 (NOS2)
   00330 Arginine and proline metabolism
    106043795 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106043795 (NOS2)
   04020 Calcium signaling pathway
    106043795 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106043795 (NOS2)
Enzymes [BR:acyg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106043795 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 106043795
NCBI-ProteinID: XP_013048949
LinkDB
Position
Unknown
AA seq 1152 aa
MLCPWQFAFKPHAAKNQSSKEKDINNNVEKDMKIHGLVKDDAKLHDLIKKQKEKPPIITS
AEKPPVNGIKASNQISRCPRHLKVRNLENGSSFLDTLHLTAKEVINCRTKACQGALMTPK
GLVRGTRDGPVPLEELLPQAVDFVKQYYTSFKESKIEEHLARLEAVTKEIETTGTYHLTQ
DELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHVQYATNNGNIRSA
ITVFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSILGDPASVEFTKLCIELGWKPKYGRFD
VVPLILQANGQDPEIFEFPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVVEINVAVL
YSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFHQEMLNY
VLTPFFYYQVDAWKTHIWHDESRRPKKREIKLSVLAKAVLFASSLMQKAMAMRSKVTVIY
ATETGKSETLANNLCSLFSCAFNTKILCMDEYNITDLEKETLLLVVTSTFGNGDSPNNGK
TLKNSLLTLKLLRKKIRYAVFGLGSTMYPEFCAFAHAIDRKLAQLGASQLTPIGEGDELN
GQEEAFRTWAVSAFKTACDIFNIRGKNSIQLPKMYTSDEIWNPKKYRILHESQTMDLAKA
LTDIHGKDIIPMKLKFRQNLQSLKSSRVTILVKLSCETNQEVRYLPGEHIGIFPGNQPEL
VHGLIAHVKDAPPADQTIRLQTCTEGGYWTSDKKIPACTLSQALTYLLDITTPPSQQLLR
KISQLVTAEGDKQRLEVLCHNTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLLTQLPYL
KPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNKISLNEVVPCFVRS
GNGFQLPKEPTKPCILIGPGTGIAPFRSFWLQRLYDLEKKGIKGGDMTLLFGCRQPDMDH
IYREETEEMKRKGVLKEVFTAYSRQPGQAKVYVQDILQNKLEAKVCNLLHEEGGHLYVCG
DIRMARDVAQTLKGILVKKLNLTEQQAEEYFFELKSQKRYHEDIFGAVFPHEVKRDVRAL
QPISPSMNQQTF
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgccttcaaacctcatgctgctaagaaccagtcctccaaa
gagaaggatatcaataataacgtggagaaagatatgaagatccatggcttagtgaaagat
gatgccaaattgcacgatctaatcaagaagcagaaagagaagccacctatcataacttca
gcagagaaacccccagtaaatggtatcaaagcttcaaaccaaatatcaagatgtccaaga
catctcaaagtaagaaacttggaaaatggatccagctttcttgacacactacacctgaca
gcaaaggaggttatcaattgccgcaccaaagcatgccaaggggcactcatgaccccaaag
ggcttggtgaggggcactagagatgggccagttcctctggaagagcttttacctcaggca
gtagactttgtcaagcagtactacacttcatttaaagagtcaaaaatagaagaacacctg
gcccgactggaagcagtgaccaaagaaatagaaacaacaggaacctaccatctgacacag
gatgaactgatctttgctgccaaacaggcctggaggaatgctccgagatgtattgggaga
atccagtggtccaatctacaggtattcgatgcacgtgactgtaaaacagccaaggaaatg
tttgagcatatctgtcgtcatgttcagtatgcaacaaacaatggaaacataaggtcagcc
atcactgtcttcccacagaggactgatgggaaacatgatttccgtgtttggaacagccag
ctcatccgatacgctggatatcaaatgccagatgggtctatcctgggagaccctgcaagt
gtggagttcacaaagttgtgcattgagcttgggtggaagccgaaatatggccgctttgat
gtagttccactcattctccaagcgaacggccaagatccagaaatatttgaattccctcca
gaaattatccttgaagtgccaatggagcatccaaagtatgagtggtttaaggagttagat
ctgaagtggtacgcgctgcctgctgttgccaacatgctccttgaggtgggaggcctggaa
tttactgcatgtcctttcaatggctggtacatggggacagagataggagtgcgagacttc
tgtgacgtgcagcggtacaatatcctgaaggaggtaggaagaagaatgggactggaaaca
aacaaactttcatcactatggaaagaccgagctgttgtagagataaatgtggctgtgctt
tatagcttccaaaaacaaaacgttactatcatggatcaccactcagctgctgaatccttc
atgaaatatatgcagaatgagtaccgtgtgcgaggaggctgcccagctgactgggtgtgg
attgtacctcctatgtcagggagcataactcctgtgttccaccaggagatgctgaactac
gtcctcactcccttcttttactaccaggtggatgcatggaaaacacacatctggcatgat
gagtcccggaggccaaagaaaagagaaataaaattgagtgtcttggcaaaggctgtactg
tttgcatcttcactcatgcaaaaagcaatggcaatgaggtccaaggtcactgtgatctat
gcaacagagactgggaaatctgaaacactagccaacaatctgtgcagtttgttcagctgt
gccttcaacactaagattctgtgcatggatgaatacaacatcactgacctggaaaaagaa
acgcttcttttagtggttactagtacttttggaaatggagattctccaaataatggaaag
acattgaagaattccttgctcaccctgaaattgctgagaaagaaaattagatatgccgtg
tttggtttgggatctaccatgtatcctgaattctgtgcctttgctcatgccattgaccga
aaactggcccagctaggggcttcacagctcactccaataggtgaaggagatgaactcaat
gggcaagaagaagcctttcgcacgtgggcagtcagtgcattcaagactgcctgtgacatt
tttaacatccgtgggaaaaacagtattcagttgcctaagatgtatacctcagatgaaatc
tggaatcctaagaaatataggatactgcacgagtctcaaaccatggacttggctaaagca
cttactgacattcatggaaaggatataattcccatgaagctgaaattcagacagaatctt
cagagtttaaaatctagtcgtgttaccattctagttaagctttcctgtgagactaatcag
gaagtgcgctacctgcccggagaacatattgggattttcccaggcaaccagccagaatta
gtccatggcctcattgcacatgttaaggatgcccctccagctgatcagactatcagactt
caaacctgcactgaaggtggctactggacaagtgacaaaaagattccagcctgcacactc
tcccaagctttgacatatttgcttgatatcactactccaccctcccaacaactgctaaga
aagatttcccagctggtaacagcagaaggagacaaacagagactggaagttctatgtcat
aacacagaagaatacaataaatggaagttttacaacagcccaaacatcctggaggtcctg
gaggagtttccttctgctgaagtctcaacagctttcttgttgactcagctgccatatctg
aaacccaggtactattccgtcagttcttcctgtgacatgacacccagagagattcatctg
acagttgcagtagtcaattacaggacaagagatggacaagggcctttgcatcatggagtt
tgcagcacatggctgaataaaataagtctcaatgaagtagtgccatgttttgtgcgcagt
ggcaatggattccagctcccaaaggagccaaccaagccctgcattctgatcggcccagga
acaggaattgctccattcagaagtttctggctgcaacgtctctatgacttggaaaagaaa
gggatcaaaggtggtgacatgacattattgtttggctgccggcagccagacatggatcat
atctacagagaagaaacagaagaaatgaagaggaaaggagttctgaaagaagtttttaca
gcttactccaggcaacctggccaagctaaagtctatgttcaagacattctccaaaacaag
ttggaagccaaagtgtgcaatctcttgcatgaagagggtggacatctgtatgtctgtgga
gatatacgcatggccagggatgttgctcagactttgaaggggatacttgtaaaaaaactg
aacctcacggagcagcaggcagaagagtatttcttcgagctaaagagccaaaaacgttac
catgaagatatatttggggctgtgttcccacatgaagtcaaaagagatgtaagagctttg
caacccatcagtccaagcatgaatcaacagacattttaa

DBGET integrated database retrieval system