KEGG   Anser cygnoides domesticus (swan goose): 106043819Help
Entry
106043819         CDS       T04896                                 

Gene name
SPI1
Definition
(RefSeq) transcription factor PU.1
  KO
K09438  transcription factor PU.1
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acyg03000]
    106043819 (SPI1)
Transcription factors [BR:acyg03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    106043819 (SPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 106043819
NCBI-ProteinID: XP_013048988
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MLQACKMEGFPLIPPPSEDMVPYESDLYRQPHDYYQYLNSDGESHGDHYWEYHPHHMHSE
FETFGDNHFTELQSVQPPQLQQLYRHMEIEQMHVLDSAIPTTHIGLNHQVSYLPRMCLQY
SSPPQPSSDEEDIERQSPPLEVSDGETDGVDPGPGIMHGETGSKKKIRLYQFLLDLLRSG
DMKDSIWWVDKEKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKK
VKKKLTYQFSGEVMGRGVTDRKHYPH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagcttgcaaaatggaaggatttcccctcattccccctccctctgaagatatg
gtaccctatgagtcagacctctaccgacagccccatgactattaccagtatctcaacagt
gatggagagagtcatggtgatcattactgggaatatcatccacaccacatgcacagtgag
tttgagacctttggagacaaccacttcacagaactgcagagtgtacagcctccccagctg
cagcagctctacaggcacatggagattgaacaaatgcatgtcttggattctgcaatccca
actacacatattggactcaaccatcaggtttcctatttgccccggatgtgcctacagtac
tcctctccaccgcagcccagttctgatgaggaggacatagagaggcagagccccccactg
gaggtatcagatggggagaccgatggtgtggaccctgggcctggaattatgcatggtgaa
acaggcagcaagaaaaagatacgtctgtatcagttccttctggaccttcttcgcagtgga
gacatgaaggacagcatctggtgggtggacaaggaaaaaggtactttccagttctcctcc
aaacacaaagaagcattggcgcaccgctggggcatccagaaaggcaatcgcaagaaaatg
acttaccagaagatggcacgggctttgagaaactatggcaagacaggggaggtcaagaag
gtcaagaagaagctgacctaccagtttagtggagaggtgatgggaaggggggtcactgat
aggaagcattatcctcattga

DBGET integrated database retrieval system