KEGG   Anser cygnoides domesticus (swan goose): 106044640Help
Entry
106044640         CDS       T04896                                 

Definition
(RefSeq) actin-85C-like
  KO
K05692  actin beta/gamma 1
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04145  Phagosome
acyg04210  Apoptosis
acyg04510  Focal adhesion
acyg04520  Adherens junction
acyg04530  Tight junction
acyg04810  Regulation of actin cytoskeleton
acyg05132  Salmonella infection
acyg05164  Influenza A
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106044640
  09143 Cell growth and death
   04210 Apoptosis
    106044640
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106044640
   04520 Adherens junction
    106044640
   04530 Tight junction
    106044640
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106044640
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106044640
  09172 Infectious disease: viral
   05164 Influenza A
    106044640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acyg03021]
    106044640
   03019 Messenger RNA biogenesis [BR:acyg03019]
    106044640
   03036 Chromosome and associated proteins [BR:acyg03036]
    106044640
   03029 Mitochondrial biogenesis [BR:acyg03029]
    106044640
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acyg04812]
    106044640
   04147 Exosome [BR:acyg04147]
    106044640
Transcription machinery [BR:acyg03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     106044640
Messenger RNA biogenesis [BR:acyg03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106044640
Chromosome and associated proteins [BR:acyg03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     106044640
    NuA4 complex
     106044640
  Chromatin remodeling factors
   BAF complex
    106044640
   PBAF complex
    106044640
   SWR1 complex
    106044640
Mitochondrial biogenesis [BR:acyg03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    106044640
Cytoskeleton proteins [BR:acyg04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     106044640
Exosome [BR:acyg04147]
 Exosomal proteins
  Proteins found in most exosomes
   106044640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 106044640
NCBI-ProteinID: XP_013050243
LinkDB All DBs
Position
Unknown
AA seq 377 aa AA seqDB search
MFDPSVLDVPAVIFDNGSGLCKAGIAGDSGPRSVITAIVGRSKAKSTMLGAGMKEYYVGE
EAQSKRGILSLNYPIDHGIVTSWDDMERIWRHVYEYELRIKATERPVLLTEAPLNPLQNR
EKMTEIMFEGFMVPAMYVAVQAALALYASARTTGIVMDSGDGVTHTVPIYEGYCLPHAVS
RLDIAGRDITEYFMRLLLESGHSFVSTAEREIVRDIKEKLCYVALDPIHETKAKPEEVMK
EYRLPDSNVIQIGSQLFRAPEVLFVPADIGIEAPGVHKMIFNSIMKCDIDVRRNLYANVL
LSGGSTLFPGLEERILREMHLQVPAGMFVRIVAPPERKYSVWIGASILTCLTSFKQMWVT
VSDYKDFGAAIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccccagcgttttggatgtcccagcagtaatctttgacaacgggtctgggtta
tgcaaggcaggtatcgcaggtgacagtggcccaaggtctgttatcacggcaattgttggt
cgctcaaaagccaaatctacaatgcttggagctgggatgaaagaatactacgttggagaa
gaagctcagtccaaaagggggatcctgtctttgaattatccgattgaccatggcatagtt
acctcctgggatgacatggaaaggatctggagacacgtctatgagtacgagctgagaatc
aaagccactgaaaggccagtgctgttgacagaagcccccctgaatcctcttcagaaccgg
gagaaaatgacggagatcatgtttgaaggcttcatggtgcccgctatgtacgtggcagtc
caggcagctctggcactctacgcctcagcccgcaccaccgggatcgtcatggacagcggg
gacggtgtcacccacacggtccccatttacgaagggtactgtctgccccatgctgtctcc
aggctggatattgctggcagggacatcaccgaatatttcatgaggcttcttctggagagc
gggcactcttttgttagcacagctgaaagggaaatcgtgagagatatcaaagagaagctg
tgctacgtagctttagaccccatccatgaaacgaaagcaaagcccgaagaagtcatgaaa
gaatacaggttacctgacagcaatgtcattcagataggcagccagctcttccgtgctcca
gaggtcctctttgtgcctgcagacatcggcatcgaagcacccggcgtgcacaaaatgatc
ttcaacagcatcatgaagtgtgacatcgacgtgcgcaggaatctctacgccaacgtcctg
ctctcgggtggctccacgctgttccccggcctggaggagcggatcctgagggagatgcac
ctccaagtgcctgcaggcatgttcgtgaggatcgttgcccccccagagagaaaatacagc
gtgtggatcggggcctccatcctcacctgcctgacgtctttcaagcaaatgtgggtcacc
gtgagcgactacaaggactttggggcagccatcgtccatcgaaaatgcttctaa

DBGET integrated database retrieval system