KEGG   Anser cygnoides domesticus (swan goose): 106044779
Entry
106044779         CDS       T04896                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04068  FoxO signaling pathway
acyg04110  Cell cycle
acyg04115  p53 signaling pathway
acyg04218  Cellular senescence
acyg04310  Wnt signaling pathway
acyg04340  Hedgehog signaling pathway
acyg04371  Apelin signaling pathway
acyg04510  Focal adhesion
acyg04530  Tight junction
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106044779 (CCND1)
   04340 Hedgehog signaling pathway
    106044779 (CCND1)
   04371 Apelin signaling pathway
    106044779 (CCND1)
   04068 FoxO signaling pathway
    106044779 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106044779 (CCND1)
   04115 p53 signaling pathway
    106044779 (CCND1)
   04218 Cellular senescence
    106044779 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106044779 (CCND1)
   04530 Tight junction
    106044779 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106044779
NCBI-ProteinID: XP_013050430
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDXXXXXXXXXQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaacgacagggtgctgcagacaatgctcaaggcggaggagacctgctcgccc
tcggtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gcgatgaattacttggacagatttttgtcgttcgaacccctcaagaaaagccgcttgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttacacagatannnnnnnnnnnnnnnnnnnnnnnnagcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatgttaaatttatttcaaacccacct
tccatgatcgcagctggcagcgtggtagcagctgtacaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system