KEGG   Anser cygnoides domesticus (swan goose): 106045013Help
Entry
106045013         CDS       T04896                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00020  Citrate cycle (TCA cycle)
acyg00190  Oxidative phosphorylation
acyg01100  Metabolic pathways
acyg01200  Carbon metabolism
Module
acyg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acyg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acyg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106045013 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106045013 (SDHA)
Enzymes [BR:acyg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106045013 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106045013
NCBI-ProteinID: XP_013050761
LinkDB All DBs
Position
Unknown
AA seq 658 aa AA seqDB search
WKHLVYNSCLDFFPQWPAACQTLARNFHFTVYGKKHASTKVSDSISTQYPVVDHEFDAVV
VGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDT
VKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQA
HRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHR
FRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCL
ITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYL
QLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVN
GEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKP
DAGEESVANLDKLRFANGTIRTSEVRLNMQKTMQSHAAVFRTGSVLQEGCEKLSQIYSDL
AHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEFDY
SKPLQGQQRKPFEEHWRKHTLSYVDVKSGKVSLKYRPVIDKTLNEEDCSTVPPAIRSY
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
tggaaacacttggtttacaatagttgtcttgatttctttccacagtggccagcagcatgc
cagactcttgcacgcaactttcacttcacagtctatggaaagaaacatgcttctacgaag
gtttctgattcgatttctacacaatatccagtagtggaccatgagtttgatgcagttgtt
gtgggtgcaggaggagcaggcctgcgggctgcatttggtttgtcagaggccggatttaat
acagcgtgtgttacaaagctgttccccaccaggtctcatactgttgctgcacaggggggg
atcaatgctgctctgggaaacatggaggacgataactggaggtggcatttctacgacaca
gtgaaaggctccgactggctgggtgaccaggatgccatacactacatgacggagcaagcc
ccagccgcggtgatagagctggagaattacgggatgccattcagtagaacagaagaagga
aaaatctaccaacgtgcgtttggtggacagagtcttcagtttggaaaaggaggacaggct
cacagatgctgttgtgttgcagaccggacaggacactcgctgttacatactctgtatggc
aggtctctaagatatgataccagctactttgttgaatattttgccttggacctgctcatg
gaaaatggagagtgtcgtggtgttattgccctttgcatagaagatggttctatacatcgt
tttagagcaaagaacactgtcattgccaccggagggtatggccgcacttacttcagttgc
acatctgcacatactagtacaggcgatggcactgctatggtcacacgagctgggcttccc
tgccaggacttggagtttgtacagtttcaccctacagggatctacggggctggctgcctt
ataacagaaggatgtcgtggagagggaggtattctaattaacagtcaaggtgaaagattt
atggagagatacgcacctgttgctaaagatctggcttccagggatgttgtatctcgttct
atgaccatagagatacgggaaggaaggggctgtggccctgaaaaagatcatgtgtatttg
cagctgcaccatttaccaccacagcagctggcaactcgtctcccaggaatttcagaaaca
gctatgatatttgctggagttgatgtcactaaagagcctattcctgttctgcccactgtg
cattataatatgggaggtattcctactaactacaaaggacaggtgattacacatgtgaat
ggtgaggataaagtggtacctggcctatatgcctgtggggaagcagcatctgcatctgtc
catggtgcaaatagacttggagcgaactcccttctggatttggtggtctttggtcgtgct
tgtgcccttactattgcagaaacgtgcaagcctggagagccagttccctccattaaacca
gatgctggtgaagaatcagtcgctaatcttgacaaattaagatttgctaacggaaccata
agaacttcagaagtgcgacttaacatgcagaagacaatgcaaagccatgcagctgtattt
cgtactggctctgtactacaagaaggctgtgaaaaacttagccaaatttatagtgatctg
gcacatctcaagacatttgacagaggtattgtgtggaacactgacttggtggagaccctg
gaactgcaaaacctgatgctttgtgctctacaaaccatctatggtgctgaggctcgcaag
gagtcccggggtgctcatgccagagaggactataaggtacggatagatgagtttgactat
tccaagccactccaaggccaacagcgcaagccatttgaagagcactggagaaagcacacc
ctttcgtatgtggatgtcaagtctgggaaggtttccttgaagtacagacctgtaattgac
aaaactttgaatgaagaagactgctcaactgttcctcctgctattcgctcatactag

DBGET integrated database retrieval system