KEGG   Anser cygnoides domesticus (swan goose): 106045703Help
Entry
106045703         CDS       T04896                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acyg01002]
    106045703 (TMPRSS9)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106045703 (TMPRSS9)
Peptidases [BR:acyg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106045703 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 106045703
NCBI-ProteinID: XP_013051788
LinkDB All DBs
Position
Unknown
AA seq 1113 aa AA seqDB search
MDQVKPVPGRKGRKASCWKLTVVAAVVGSVMALYLGILLACHPVGETSFEHTVELQGIMF
NSSLQRENSDYYRMLTPALERLFLSSFQDSQLDWSCTGCTILGYRNGNSSVLVRFRLRFS
PQDSHPLSSATEEEALRHGLAAALHEQGLSLAAYGTISSASLTGPSEVSPYRPGLKSGSC
PGDLFTCRNKQCVSKENPECDGQKDCPDASDEKGCDCGSRPAMQTATRIVGGSEASRGEF
PWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYTGTTSISGMDKGTVKMG
IARIIPHPSYNTDTADYDVAVLELKRPVTFTKYIQPVCLPDAGHHFPTSKKCLISGWGYL
KEDFLVKPEFLQKATVELLDQTLCSSLYSHALTDRMLCAGYLEGKIDSCQGDSGGPLVCE
EPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWILDAISPFPNSIARTVPLIHSSTN
SNVVTTEELNTTTRAIPTTSPAPAASEPAPASRPQECGGRPGLSKPSKIVGGTDASRGEI
PWQVSLREDSMHFCGATIIGDRWLLSAAHCFNETDPEEIEAYMGTTSLNGTDRNTVKVNI
TRVIQHPLFNPILLDFDVAVLELAEPLVFSKYIQPICLPLTVQKFPVGKKCIISGWGNLQ
EGNFTKPESLQKASVGIIDQKTCNFLYNFSLTDRMICAGFLEGKIDSCQGDSGGPLACEV
TPGVFYLAGIVSWGIGCAQAKKPGVYSRITKFYDWILDTISQYASPGTSTPSSSAITSTS
TAAILTRRASTTATIAVNRTTLSTKTTTPTKETSTALGTTEPAKPTQTPVVPCTSFTFRC
SSNVCIGKENPECDGVVDCSNGFDESNCDCGLTTALAFSKIVGGSTAARGEWPWQVSLWL
RRKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAFLGTPFLSGIDGKMEKIFRIYKHPF
YNVYSLDYDVALLELNTPVKFSSTIKPICLPDSSHIFHEGARCFITGWGSTKEGGLMSKH
LQKAAVNVIGDQACKKFYPVQISSRMVCAGFPHGTVDSCSGDAGGPLACQEPSGRWFLAG
ITSWGYGCARPYFPGVYTKVTAVQGWIAQNLKL
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagtaaagccagtcccaggcagaaaggggaggaaggccagctgctggaagtta
accgtcgtggccgccgtagtgggcagcgtgatggccctctacctggggatcctgctggcc
tgtcatcccgtgggagagaccagctttgagcacacagtggagctgcaaggaatcatgttc
aacagcagcttgcagagggagaactcagactattacaggatgctgacacccgcgctcgag
aggctgtttctgtccagtttccaggactcccagctggactggagctgcactggttgcacc
atcctgggctacaggaatgggaactcgagcgtacttgtccgtttccgcctccgcttcagc
ccccaggattcccatcccctgagctctgccacggaggaggaagctctcagacatggcctg
gcagctgccctgcacgagcagggtctctccctggctgcctatgggacaatatcctcagct
tctcttacaggtcccagtgaggtttctccatacagaccaggactgaaatcagggagctgc
cctggagacttgttcacttgccgcaacaagcagtgcgtgtcgaaagaaaacccagaatgt
gacggccaaaaggactgccctgatgcctctgatgaaaagggctgcgactgcgggagccgc
cctgccatgcagactgccaccaggatagtcggaggctcagaggcatccagaggggagttc
ccatggcaagtcagtctgcgagagaacaatgaacatttctgtggtgctgcaatcctcacg
gagaagtggctggtgtctgccgctcactgctttactgagtttcaggacccagccatgtgg
gcagcttacacggggaccacctccattagcggtatggacaaaggcacagtaaaaatgggc
atcgcacggatcatcccgcatccctcctacaacacagacacagctgactacgatgtggct
gtgctggagctgaagagacctgtgacctttactaagtacatccagcctgtgtgcctgcca
gatgctgggcatcacttccccaccagcaagaagtgccttatctctggctggggctacctc
aaggaggatttcttggtgaaacctgagttcctgcagaaagcaacagtggagctgctggac
cagacgctgtgctccagcctctacagccatgccctcacagacaggatgttgtgtgctggc
tacctggaggggaaaatagattcctgccagggtgactctggtgggcccctggtttgtgaa
gaaccatctggcaagttcttcctggcaggaatcgtgagctggggaattggatgtgctgaa
gccagacggcctggggtttacacacgtgttaccaaactgagagactggatcttggatgct
atttctccctttcccaactccatagcgcgtactgtccccctaatacactccagtactaac
agtaacgtggtcaccactgaagagctcaacaccaccaccagagcaatccccaccacctca
ccagccccagctgccagcgagccagcacctgcatccagaccgcaagagtgcggaggaaga
cctgggctctctaaacccagcaagatcgtgggaggaacagatgcttccagaggagagatc
ccctggcaagtcagcctgagagaagactcgatgcatttctgtggagccaccataatcggg
gaccgctggctgctgtcagcagctcactgcttcaatgagacagatccagaagagattgaa
gcctacatgggaacgacatcactaaatggaacagataggaacacggtgaaagtcaacata
acgagagtcatccagcatcctctcttcaaccctatccttctggacttcgatgtggctgta
cttgagctggcagaaccccttgtcttcagcaaatacatccagcctatctgcctcccactt
acggtgcagaagtttcctgttggcaagaaatgcatcatttctgggtggggaaacctccaa
gaggggaatttcaccaagcctgagagcctgcagaaagcttctgtgggcatcatagaccag
aagacttgcaacttcctctacaacttctccctcactgaccgaatgatctgtgctggcttc
ctggaagggaagatagactcgtgccagggagattcaggtgggcccttggcctgtgaggtc
accccaggcgtgttttatctggctggcatcgtgagctggggaattggctgtgcccaggct
aagaaacctggcgtgtactccagaattaccaaattctacgactggatcctggacaccatc
tcacagtatgccagtcctggcacaagcactccctccagttcagccatcaccagcacttct
actgcagccatcctcacacgtcgcgccagtacaacagctacaatagctgtcaacagaacc
accctgagcacgaagaccaccacacccacgaaagaaacctccacagctctgggaaccact
gagcctgccaagcccacccaaaccccagtggtgccttgtaccagcttcaccttcaggtgt
tccagcaatgtctgtataggaaaagaaaatcctgaatgtgatggagttgttgactgcagc
aatggctttgatgaaagcaattgcgactgcggcttaactactgccctggccttcagcaag
atcgtgggtgggagcactgcagctcgaggagaatggccctggcaagtcagcctctggctt
cggcggaaggagcacaagtgcggggctgtcctcatcgctgacaggtggctgctctctgca
gctcactgctttgatatttacagtgaccccaaaatgtgggtggcctttctaggaacaccc
ttcctgagtggcatcgatggcaaaatggagaaaatattccgtatctacaagcaccctttt
tacaacgtctacagcctggactacgacgtggcgctgctagagctgaacacgcccgtcaag
ttcagcagcaccatcaaacctatatgtctcccagacagttcacacatcttccacgaagga
gccagatgcttcatcacaggctggggttccacgaaggaaggaggtctcatgtcaaagcat
ctgcaaaaagcagcagtgaacgtgattggagaccaggcctgcaaaaagttctaccctgtc
cagatcagcagcaggatggtgtgtgccggtttcccacacggtaccgtcgacagttgttca
ggtgatgctggtggtcctctggcatgtcaagaaccctcaggaaggtggttcctagcagga
atcacaagctggggctacggctgtgccaggccgtactttcctggtgtctacactaaagtc
acagctgtccaaggctggattgcgcagaacctcaagctctga

DBGET integrated database retrieval system