KEGG   Anser cygnoides domesticus (swan goose): 106046190Help
Entry
106046190         CDS       T04896                                 

Gene name
SUV39H2
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acyg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106046190 (SUV39H2)
Enzymes [BR:acyg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106046190 (SUV39H2)
Chromosome and associated proteins [BR:acyg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106046190 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106046190 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 106046190
NCBI-ProteinID: XP_013052506
LinkDB All DBs
Position
Unknown
AA seq 450 aa AA seqDB search
MGREARSELCLSLRDAFAVGKRSPLVLRRFLPPGRVLRQRLPSRALVVPSWYVPCLASLE
TLQELCRKENLRCKSIGITNRSLKSYEVEYLCDYKVEEGTEYYLVKWKGWPESSNTWEPQ
KNLNCPLLLQNFLSDKNEYLSRVKEGKALKVRNHVKALKPAVADYIVRKAKQRIALRRWK
EELNRKKNHRGMILVENTVDLEGPPLDFYYINEYKPAPGINVINGITTGCECSDCPAEKC
CPKEAGFILAYNKRKKLKIQPGLPIYECNSFCRCGPNCPNRIVQKGTQYSLCIFRTNNGR
GWGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQLYDNQGNTYLFDLDYDSDEFTVDAAR
YGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRTIKAGEELTFDYQMKGSIDLT
SDSADGLSPSRKRIRTVCKCGAVCCRGYLN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggaagggaggctcgctcggagctgtgcctctcgttacgggatgctttcgccgtaggg
aaacgctctcccttggtcttaaggcgctttctgccccctggaagggtgttgcggcagcgc
ctgccctccagagcgttggttgttccgtcctggtatgtgccatgtctagcttcacttgag
accctccaagaattatgtaggaaggaaaatctcagatgtaaatccattggaatcaccaac
aggagtctaaagagttatgaggtggaatatttgtgtgactacaaggtagaagagggcacg
gaatactatcttgtgaaatggaaaggatggccagagtcttcaaatacttgggagcctcag
aaaaatctgaactgtccgttgcttcttcaaaactttcttagtgacaagaacgaatactta
tctcgagtgaaagaaggcaaagcactgaaagtgagaaaccatgttaaagccttgaaacct
gcggtcgcagattacattgtgaggaaggctaagcaaagaatagctctgcggagatggaaa
gaagaactcaacaggaaaaagaatcatagaggaatgattctcgtagaaaacactgtggat
ctcgaaggtcctcctttagacttctactacattaacgagtataaacctgctccgggaata
aatgtaatcaatggaataacgactggctgtgaatgctcagactgccctgctgagaagtgc
tgtccaaaggaggctggctttattttggcttataataaaagaaagaagctgaaaatccag
cctggcttgcccatctatgaatgcaactcattttgtaggtgcggtcccaactgcccgaat
aggatagtacagaagggcacgcagtattctctttgcatcttccgaactaacaatggacga
ggctggggagtaaaaaccctccagaaaattaaaaccaacagtttcgtgatggagtatgtc
ggagaggtgattacaagtgaggaagcagagagacgaggccagctctatgacaaccagggc
aatacgtacttgtttgatttggactatgactcagacgaatttacagtggatgcggctcgc
tatggaaatgtgtcccactttgtgaatcacagctgtgatccaaatctccaagtcttcaac
gtgttcatcgacaacctcgacctgcgtcttcctcgaatagcactgttttccacgagaacc
atcaaggctggagaagagctcaccttcgactaccagatgaaaggttcgatagatctgact
tcagactctgcagacggtctcagcccctccagaaagaggatcagaacagtgtgtaaatgt
ggagctgtgtgttgcagaggttatctcaactga

DBGET integrated database retrieval system