KEGG   Anser cygnoides domesticus (swan goose): 106046246
Entry
106046246         CDS       T04896                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106046246 (TGFA)
   04012 ErbB signaling pathway
    106046246 (TGFA)
SSDB
Motif
Pfam: DUF1180 Collectrin Adeno_E3_CR2 TMEM154 DAG1 UPF0560 Insulin_TMD
Other DBs
NCBI-GeneID: 106046246
NCBI-ProteinID: XP_013052602
LinkDB
Position
Unknown
AA seq 125 aa
PRCHSGYVGTRCEHADLLAVVAANQKKQTITALVVVAVVASVVLIAVCVLIHCCRLRKRC
GCCREPLCGQEKPAGLLKGSASCSAKLQGGSPRRKLLAAIRGQQRGVTTLQRRKRRQRLH
LGFAK
NT seq 378 nt   +upstreamnt  +downstreamnt
cccaggtgccactcggggtacgtggggacgcgctgcgagcacgccgacctcctggccgtg
gtggccgccaaccagaagaagcagacgatcaccgccctggtggtggtggccgtggtggcc
tcggtcgtgctcatcgccgtctgcgtgctcatacactgctgccggctgcggaagcgctgc
gggtgctgccgggaacccctctgcggccaggagaagccggccgggctcctgaagggcagc
gcgtcctgctcagcaaagctccagggtggcagcccccgaaggaagttgctcgcagctatt
cgggggcagcaacgcggcgtcaccaccctgcagcgacggaaacgacggcaacgtttgcac
cttggatttgcaaagtaa

DBGET integrated database retrieval system