KEGG   Anser cygnoides domesticus (swan goose): 106046740Help
Entry
106046740         CDS       T04896                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00052  Galactose metabolism
acyg00500  Starch and sucrose metabolism
acyg01100  Metabolic pathways
acyg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106046740 (GAA)
   00500 Starch and sucrose metabolism
    106046740 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106046740 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acyg04147]
    106046740 (GAA)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106046740 (GAA)
Exosome [BR:acyg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106046740 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 106046740
NCBI-ProteinID: XP_013053349
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
PRRPRPRLSPCPRPQLRDPARQRYEVPLATLRVSARAASTLYGVQVHEDPFGLVVSRWPG
GQVLLNTTVAPLFFADQFLQISTSLPSRFISGLGEHLAPLVLDTAWTKVTLWNRDMAPVP
QVNLYGSHRLGAALGPRLGRAHGARLRWVSAGEGLGHGAGLRASPHLAPPVLVPPPDVVL
QPSPALTWRTTGGILDFYVFLGPDPKSVVRQYLDVVGRDPQQDVALGHRRSWDAGRCWQR
VGAAAGNAARFPLDVQWNDLDYMDAKRDFTFNKETFKDYPDMVRDFHQRGLRYVMIVDPG
ISSSGPPGTYKPYDDGLKRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETHEWWHDMVKD
FHDRVPFDGMWIDMNEPSNFVEGSQDGCPNNSLEKPPYVPGVFGGRLQAGTICASSQQYL
SSHYNLHSLYGLTEAIASHDALVRIRGKRPFVISRSTFAGHGRYAGHWTGDVESNWEQLS
YSVPEVLLFNLFGVPLVGADICGFLGDTSEELCVRWTQLGAFYPFMRNHNDHGNRPQDGP
IELPPAQLLRTSASCEASLVDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAFSTA
ESRKKGMALVVALTPDGFARGELFWDDGESWQSFEKGDYTETLFLAAHGAVLSQILRASS
HLDGILLEAVTILGVTSPPRQVLANGARVDDFSYRSDTQVLSVPVSLPMWEQFVITWS
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
ccccgccgcccccggccccggctgagcccctgtccccgcccgcagctccgcgacccggcc
cggcagcgctacgaggtgcccctggccacgctgcgggtgagcgcccgggcggcctccacg
ctctacggggtgcaggtccacgaggatcccttcggcctcgtcgtctcccggtggcccggc
ggccaggtcctgctgaacaccaccgtcgcgcccctgttcttcgcagaccagttcctgcag
atctccacctccctgccctctcgtttcatctctgggctgggggaacacctggcaccgctc
gttctcgacacggcctggaccaaggtcaccctctggaaccgggacatggcgccagtgccc
caggtcaacctgtacggctcccaccggctgggggcggctctggggccgaggctgggccgt
gctcatggggccaggctccgatgggtgagtgctggggaggggctggggcacggggctgga
ctgagggccagtcctcatctcgctcctccggtgctcgtgcctcccccagacgtggtcctg
cagccgagcccggccctgacgtggcgcacgacgggcgggattctggacttctacgtcttc
ctgggccccgaccccaagagcgtggtgcggcagtacctggatgtcgtgggtagggacccg
cagcaggatgtggccctggggcacagacgctcctgggatgccgggcgctgctggcaacga
gtgggtgctgccgctggcaacgctgcccgcttccccctggacgtgcagtggaacgacctg
gattacatggacgctaagagggatttcaccttcaacaaggaaacgtttaaggactacccg
gacatggtgcgggatttccaccagcgaggcctgcgctacgtgatgatcgtggatcccggg
atcagcagctcagggcctcctggcacctacaagccctacgacgatggactgaagcgaggg
gtgttcatccgaaatgccacggggcagcccctcatcgggaaggtgtggccaggcccgacg
gctttcccagacttcaccaacccggagacgcacgagtggtggcacgacatggtgaaggac
ttccacgaccgggtgcccttcgatggcatgtggattgacatgaacgagccatccaacttc
gtggagggctcccaggacggctgccccaacaacagcctggagaagcccccgtacgtgcca
ggcgtgttcgggggacgcctccaggcaggaaccatttgtgcctccagccagcaatacctc
tcctcgcactacaacctgcacagcctgtacgggctgaccgaggccatcgcttcccatgac
gctctggtgaggatccggggcaagcgtcccttcgtcatttcacgctccaccttcgctggg
cacggccgctacgctgggcactggacgggggacgtcgagagcaactgggagcagctgtcc
tactccgtgccagaggtgctgctcttcaacctcttcggggtgccgctggtgggtgccgac
atctgcgggtttttgggcgacacatccgaggagctgtgcgtgcgctggacccagctgggc
gccttctaccccttcatgaggaaccacaatgaccacggcaaccggccacaggacgggccc
attgagcttcccccagctcagctcttgaggacttctgcctcctgtgaggcttcactcgtg
gactcgaccatccacagcaaaggccagtggatcctcttgccggctcccctggacaccatt
aacgtgcacgtccgagcggggcacatcctgcccctgcaggagcctgcgttcagcactgcc
gagtcccgcaagaaggggatggccttggtggtggccctgacgccggacggcttcgcccgg
ggagagctgttctgggacgatggggagagctggcagagcttcgagaagggggactacacc
gagaccctcttcctggccgcacacggcgccgtgctcagccagatcctgcgggcgagcagc
cacctcgacgggatcctgctggaggccgtgaccatcctgggtgtcaccagccctccccgg
caggtcctggccaacggtgcccgcgtggatgacttctcctaccgcagcgacacccaggtg
ctgagcgtccccgtgtcgctgccgatgtgggagcagtttgtgatcacttggtcctga

DBGET integrated database retrieval system