KEGG   Anser cygnoides domesticus (swan goose): 106046936Help
Entry
106046936         CDS       T04896                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04210  Apoptosis
acyg04625  C-type lectin receptor signaling pathway
acyg04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106046936 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106046936 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106046936 (MAP3K14)
   04672 Intestinal immune network for IgA production
    106046936 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acyg01001]
    106046936 (MAP3K14)
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     106046936 (MAP3K14)
Protein kinases [BR:acyg01001]
 Serine/threonine kinases: STE group
  Other
   106046936 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 106046936
NCBI-ProteinID: XP_013053646
LinkDB All DBs
Position
Unknown
AA seq 943 aa AA seqDB search
MAVMGITCQGAPDPTVKHKKELTATKGLNKTVSEKQSSVCKVEDTKKGIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTRKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ETHQSTLLRNNFWLSELNKDLIYDPLPFEKPEKVLSTGKLHLPKSQYKTELHKLISPVQC
LNHVWKLHYQRDSVPQPETLHPFPYNIMPPHFPHLDSPLHHMKLNALKTYFHGDLNYQDG
EHRLSGLNLEYSFPNCVNQSMKNSSDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEQFQKADENEGVLLTEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTS
PWKGEYREPRHLSLNKENNPQTSLSPTVSPVSETRSDPKLADKVSCASPVLPPPPLEQTE
EVGGTPWNVCKELSGIWDPPPLSSTPLPLKSCSHVEKATTISEQELQQLEIELFLNSLSQ
PYSLEEQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQTDGQSFSFNN
LLNRSRHTDTPSYFNGVKIQVQLLSGENLHIRDFQRTKVGDIATGISSQVRVPAFSLVTK
EGQPVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacgtgccaaggagctcctgatccaactgtcaagcataagaag
gagctcacagctacaaaggggctgaacaagacagtgagtgaaaagcaaagtagtgtttgc
aaagtagaagatacgaagaagggcatctttcatagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggaattcagccccactttatcagagagatctttt
attgctcatagtaaacgttacagccgctcagacagtcttgatcaaatccccaacaatgtg
gcccatgcaacggaggggaaaatggcacctacctgttggagagggaggcatcgtggtaaa
acaagaaagaaacgtcacaagaaacgatccaagctgaaaatacagacagtggctgctggc
aggcgaggtcccagaactccagaacaagagagctgcaccccaattccagtccaggaggat
gaaacacaccaaagtactctcctcagaaacaatttttggttgtcagaacttaacaaggat
ttgatttatgatccgctgccatttgagaaaccggagaaagttctgtccacaggcaaactc
catttaccaaagagccaatacaaaacagaactgcacaagctgataagccctgttcagtgc
cttaatcacgtgtggaaactgcactatcagagggacagtgttccacagcctgaaactctc
catccctttccatacaacataatgccccctcatttcccacatctggacagtcctctccat
cacatgaaactgaatgctctgaagacatatttccatggcgatctcaactatcaagacggt
gagcatcgcttatctgggctaaacttggaatatagtttccccaactgcgtcaaccagtcc
atgaaaaacagttcggacaagatttctgtggaagaatacttggtagacgccttgaagggg
agcgtgagtctcggtgaaccacaaaatttagccagcctagccaagacgtggagaggaggc
ggtctggacctgaaggaacaatttcaaaaagcagatgaaaacgaaggcgtgctacttact
gagaaactaaagccagtggattatgagtaccgagaagaagttcattggaccaagtgtcat
ggttccttgggcattggctcttttggagaagtatacaaaatagaggacaaacagacagga
tttcagtgtgctgccaaaaaggtacaagttgaacacttccgtgcagaggagttgacgacg
tgtgctgcgataaccagtcctaaagttgtccccttgtatggagctgtgaaggaaggacct
tgggtgaccatcttcatgaagctgatggagggtggctcactaggtcagctaattaagcag
agtggctgcctgccagaggacagagccctcagttatttgggccaagcattagaaggattg
gagtatcttcatgctcaaaacattctccatggagatgtaaaagcggaaaatgtgcttttg
tctgacgatggaagcagagctcttctgtgtgattttggtcactctgctcaccttcatcca
gatggcttgggaaagtgcttggtcacagggaactatgtgcctggcacagaaactcacatg
gctccagaggtggtcatgggaaaacgctgcgactccaaagtggatgtctggagcagttgc
tgtatgatgctgcacatgcttaatgggtgtcacccttggacccaatattacaatcatcct
ctctgtctgaagatagctaaagagccacctcctctgagggaaattccaccttcctgcaac
cctctcactgctgaaattattaaaatgggtctggagaaagagcctgttcagcgagcatct
gcgtctgaactgaaaaccaagaccagtgttgcacttgaagaagtgggaggtgtgacaagc
ccctggaaaggcgaatacagagagcctagacatttgtctctgaacaaagaaaacaatcca
cagacatccctgtcccccacagtgagcccagtttctgagactcgttctgaccccaaattg
gcagacaaagtttcttgtgcaagcccagtcctaccaccaccacctctggaacaaacggag
gaggttgggggaaccccttggaacgtgtgcaaggagttatctgggatctgggatccacca
ccgctctcctcgactcctctccccctgaagagttgcagccatgtggagaaagcaacaacc
atttcagaacaagagcttcagcagctggaaatagaactgtttttgaacagcctttcacag
ccttactcgctggaagagcaagaacaaatgctttcatgtctcagcatcgacagcccgttt
gtgtcagatgccagtgagaagaactccatgaaggcttcgcatagcttgagggacactatg
agctcagggattcattcctggaacagccagacggatggacagagcttcagctttaacaac
ctactgaatcgcagccgtcacacagacactcctagctatttcaatggagtgaaaatccag
gtccagttgctaagtggagaaaatttacacatcagggatttccagagaacaaaggtggga
gacattgccactgggataagcagccaggtacgggtccctgccttcagtctggttaccaaa
gaaggccagccagtgcactacgacatggaggtccccgactctggtattgagctgcagtgc
acccttgcccctgactgcagtgtcagctggacgtggagagtcaaacacggtcaactggag
aacaggccgtga

DBGET integrated database retrieval system