KEGG   Anser cygnoides domesticus (swan goose): 106047132Help
Entry
106047132         CDS       T04896                                 

Gene name
TGM2
Definition
(RefSeq) LOW QUALITY PROTEIN: protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
Enzymes [BR:acyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     106047132 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 106047132
NCBI-ProteinID: XP_013053933
LinkDB All DBs
Position
Unknown
AA seq 714 aa AA seqDB search
MCGARPRPGAGISLSAREDAAEGRASPTAASAELELETWDLQCESNGREHRTAEMGCQQL
VVRRGQPFTITLHFSGRGYEEGVDKLAFNVETGPCPIETSGTRSHFALTDFPEEGAWSAV
VQQQDGAALCVSLCSPAXGRYSLTLEASTGYQGSSFHIGDFVLLFNAWHPEDTVYLRDED
ERREYVLSQQGLIYQGARDYITSTPWNFGQFEDDILAICLNLLDTNPKFLRDQNRDCSRR
NDPVYIGRVVSAMVNCNDEDRGVLLGRWDDHYDDGMSPMAWIGSVDILKRWKKFVSQPVK
YGQCWVFAAVACTVMRCLGIPSRVVTNYNSAHDTNGNLVIDRYMNETGMEERRSKDMIWN
FHCWVESWMSRPDLAPGYDGWQALDPTPQEKSEGVYCCGPAPVKAIKEGDLQMKYDIPFI
FAEVNADVVYWIVQRDGSQRKSTHSSVVGKNISTKSVGRDSREDITHNYKYPEGSEKERE
VFAKAEHEKSSLSEGDEGLHVKIKLSEGANNGSDFDVFAVISNDTDTERVCRLMLCARTA
SYNGTVGPQCGMKDLLNLTLGPRTVQSVPLRILYEKYGPCLTQDNIIKVVALLTEYETGD
VVLAMRDVYIQNPEIKIRVLGEPMQNRKLVAEITLVNPLAVPLNNCVFVVEGAGLTEGQR
IKELEDPVGATQHPRTRRVSPVSHSFVPRKKQPQISLRLIVSSHTDPFRQQHRA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggggcacgtccccgtcccggggccgggatctctctctctgcaagggaagacgct
gcagaggggagagcttcacccactgctgcctctgcagagctggagctggagacgtgggac
ctgcagtgcgagagcaatggccgggagcaccgcacggcggagatgggctgccagcagctg
gtggtgcggcgggggcagcccttcaccatcaccctgcacttctccggcaggggctacgag
gagggggtggacaaactggccttcaacgtcgagacggggccctgccccatcgagacgtcg
ggaaccaggtcccactttgccctgaccgacttccccgaggagggggcctggagcgccgtg
gtgcagcagcaggacggggccgcgctctgcgtctcgctctgctcccccgccnnaggccgc
tacagcctgacgctggaggcctccaccggctaccagggctccagcttccacatcggggac
ttcgttctgctcttcaacgcctggcacccagaggacacggtctacctccgagacgaggac
gagcgccgcgagtacgtgctgtctcagcaggggctcatctaccagggcgcccgggactac
atcacctccaccccctggaacttcgggcagtttgaagatgacatcttggccatctgcctc
aacctgctggacacaaaccccaagttcctgagggaccagaaccgggactgctcccgccgc
aacgaccctgtttacatcggcagggtggtgagcgccatggtcaactgtaacgatgaggac
cgcggggtgctgctgggacggtgggacgatcattacgacgacgggatgagcccgatggcc
tggattggcagcgtggatattctgaagcggtggaagaagtttgtgtcccagccagtcaag
tatggccagtgctgggtcttcgctgccgtggcgtgtaccgtcatgcgctgcctgggcatc
cccagccgggtggtgaccaactacaactcagcccacgacaccaacggcaacctggtcatc
gaccgctacatgaacgagacggggatggaggagaggcgctccaaggacatgatatggaac
ttccactgctgggttgaatcctggatgtcccggccggacctggcgcctggctatgatggg
tggcaggcgctggacccgaccccccaggaaaagagcgaaggggtttactgctgcgggccg
gcccccgtcaaggccatcaaggagggcgacctgcagatgaagtacgacatccccttcatc
ttcgcggaggtgaacgccgacgtggtgtactggatcgtgcagcgcgacggctcgcagagg
aagagcacgcactcctcggtggtggggaagaacatcagcaccaagagcgtgggcagggac
agccgcgaggacatcacccacaactacaagtacccggaggggtctgaaaaggagagagaa
gtgtttgccaaggcagagcacgagaagagctccctcagcgagggcgacgaggggctgcac
gtcaagatcaaactgtcggagggcgcgaacaacggctccgacttcgacgtcttcgccgtc
atcagcaacgacacggacacggagcgcgtgtgcaggctcatgctgtgcgctcgcaccgcc
agctacaacggcacggtgggcccgcagtgcggcatgaaggacctgctcaacctcaccctc
gggccccgcacggtgcagagcgtgcccttgcgcatcctctacgagaagtacgggccgtgc
ctgacccaggacaacatcatcaaggtggtggccctcctgaccgagtacgagacgggtgac
gttgtgctggccatgagggacgtctacatccagaatccggagatcaagatcagggtttta
ggggagccgatgcagaatcggaagctggtggcagagatcacgctggtgaaccccctcgca
gtcccgctgaacaactgcgtgttcgtggtggagggagctggcctcaccgaagggcagagg
atcaaggagctcgaggaccctgtgggagccacccagcacccacggacaaggcgagtgtct
cccgtcagccactcgttcgtccccagaaagaaacagccccaaatcagcttacgattgatc
gtcagctcccacactgacccatttcggcagcagcaccgagcttga

DBGET integrated database retrieval system