KEGG   Anser cygnoides domesticus (swan goose): 106047143Help
Entry
106047143         CDS       T04896                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acyg01002]
    106047143 (MMP9)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     106047143 (MMP9)
Peptidases and inhibitors [BR:acyg01002]
 Metallo peptidases
  Family M10
   106047143 (MMP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_4 Reprolysin_3 Reprolysin_5 DUF4953 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 106047143
NCBI-ProteinID: XP_013053944
LinkDB All DBs
Position
Unknown
AA seq 741 aa AA seqDB search
MGLVLLAPLALALLALSCRAAPLQTKPQAVVTFPGELLSTLSDVELAESYLLRFGYTTEA
EVRRSSKHVSLAKALRKMQKQLGLKETGELDSSTLEAMRAPRCGVPDVGGFLTFEGDLKW
DHMDLTYRVMNYSPDLDRAVIDDAFKRAFKVWSDVTPLTFTQIYSGEADIMIMFGSQEHG
DGYPFDGKDGLLAHAFPPGSGIQGDAHFDDDEFWTLGTGLVVKTRYGNANGASCHFPFVF
EGRSYSRCITEGRTDGMPWCATTASYDADKTYGFCPSELLYTNGGNSDGSPCVFPFIFDG
TSYDTCTTDGRSDGYRWCATTANFDQDKKYGFCPNRDTAVIGGNSQGDPCVFPFTFLGQS
YSACTSQGRQDGKLWCATTSNYDTDKKWGFCPDRGYSIFLVAAHEFGHSLGLDHSSVREA
LMYPMYSYVQDFQLHPDDVQGIQYLYGRGSGPEPTPPEPLPTEEPQPLPTEAGSASTTEE
EETLEPTAEPSPVDPSRDACMEKNFDAITEINGELHFFKNGKYWTRSSFWKSGIQGAFST
ADTWPGLPAVIDAAFQDVLTKRVFFFSGRQFWVFSGKSMLGPRGIEKLGIGKEASRISGA
LQRGRGKVLLFSGENYWRLDVKVQRVDKGYPRATDDVFTGVPLDARNVFLYQGEQRPVGM
GGPGCHPLCCPQPPTGWAPPPPRLGAGQGLHRPGAGPRVPRGCGERLGSLQRGPSARGWV
PPVGFGSGELGGWLPLHAAVT
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggggctcgtcctcctggccccgctcgccttggcgctgctggccctctcctgccgcgca
gccccgctgcagaccaagccgcaggctgtcgtcacgttcccgggggagctgctcagcacc
ctgtcggacgtggagctggcggagagctacctgctgcggtttggctacaccacagaggcg
gaggtgaggaggagcagcaagcacgtgtccctggccaaggcgctgcgcaagatgcagaag
cagctggggctgaaggagacgggggagctggacagcagcaccctggaggccatgcgagcc
ccccgctgtggggtccccgacgtggggggattcctcacctttgagggggacctcaaatgg
gatcacatggacctcacgtaccgggtgatgaactactcccccgacctggaccgtgctgtg
atagacgacgccttcaagcgagcattcaaggtgtggagtgatgtgacccccctcaccttc
acccagatctacagtggcgaggcagacatcatgatcatgttcggcagccaagagcacggc
gatgggtaccccttcgacggcaaggacgggctcctggcccacgcctttcccccaggcagc
gggatacagggcgatgcccactttgatgacgacgagttctggaccttgggaactggctta
gtggtgaagactcgctatgggaacgccaacggggccagctgccacttccccttcgtgttc
gagggccgctcttattcccggtgcatcacggaggggcgcacggatgggatgccctggtgt
gccaccaccgccagctatgatgccgacaagacctacggcttctgccccagcgaactgctc
tacaccaacggtggcaacagcgacgggtccccctgcgtcttccccttcatctttgacggc
acctcctacgacacctgcaccacggacgggcgctctgatggctaccgctggtgcgcgacc
acagccaacttcgaccaggacaagaaatacggcttctgccccaaccgagacacagcggtg
atcggcggcaactcccaaggggacccgtgcgtcttccccttcaccttcctggggcagtcc
tacagcgcgtgcaccagccagggccggcaggatgggaagctctggtgtgccaccaccagc
aactacgacactgacaagaagtggggcttctgcccggacagaggttacagcatcttcctg
gtggctgcccacgagtttgggcactcactggggctggaccactccagcgtgcgcgaggcg
ctgatgtaccccatgtacagctacgtccaggacttccagctgcacccagacgatgtccag
ggcatccagtacctctacggtcgtggctctggccccgagcccacccccccagagcctctg
cccaccgaggagccccagcccctgcccaccgaggctggcagtgcctccaccacggaggag
gaggagacgctggagcccacagctgagcccagccctgtggaccccagccgggatgcctgc
atggagaagaacttcgatgccatcacagagatcaacggggagctgcatttcttcaagaac
gggaaatactggacccgctcgtccttctggaaatcgggcatccagggggccttctccacc
gcagacacctggcctggcctcccggctgtcattgacgcagcgttccaggatgtgctcacc
aagagggttttcttcttttctggtcggcagttctgggtgttttctggcaagagcatgctg
ggcccccgcgggatcgagaagctgggcattgggaaggaagccagccgcatctcgggggcc
ctgcagcggggacgtggcaaagtgctgctcttcagcggggagaactactggcggctggat
gtgaaggtccagagggtggataaaggctacccccgtgccactgacgatgtcttcaccggc
gtcccccttgatgcgcgcaatgtcttcctgtaccaaggtgagcagagacccgtcgggatg
ggggggccgggctgccaccccctgtgctgcccccagcctcccacaggctgggctccccct
cctcctcgcctgggtgccgggcaggggctgcatcgccccggtgctggccccagggtgcct
cgtggctgtggggagcgcctggggtccctgcagcgaggcccctcggccaggggctgggtc
ccgcccgtgggtttcggcagcggggagctgggcggctggctgcctctgcacgcggctgtt
acgtaa

DBGET integrated database retrieval system