KEGG   Anser cygnoides domesticus (swan goose): 106047148Help
Entry
106047148         CDS       T04896                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106047148
Enzymes [BR:acyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     106047148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core MG2
Motif
Other DBs
NCBI-GeneID: 106047148
NCBI-ProteinID: XP_013053948
LinkDB All DBs
Position
Unknown
AA seq 751 aa AA seqDB search
MFKGTTFSINLPCIFLALKITNINWQSKLNKAAHHTSDYSNTEVILRRGQAFTISLSFRT
IVQPWDNFTFIASTESFNVVIEIITDSGLSHTAVIQNCCLLFPLAGPSPAESQQTKVIFN
LSEEGASGWSATQEHSEHGCMNFTIVSPANAVIGRYKLKLQIDSGNKVSSALLGQFVLLF
NPWCPNDDVYMANEKDRQEYVLNDSGIIFHGLEKYIQQEAWNYGQFEEDILDISLAILDR
SLNHRKDPSTDVSNRNSPIYVSRVISAMVNSNDEKGVVEGKWNGKYCSGTNPLHWSGSVT
ILRKWYRGRYKPVRYGQCWVFAGVMCTVLRSLGIPTRVITNFNSAHDRNINLSIDKYIDV
SGKTLHLTEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDATPQERSKGIFQCGPASTKAI
KEGDVNLDYDSSFVFAAVNADCVTWIHYSNKRKERIYSNTRKIGKFISTKAVSTNSRVDV
THNYKYPEGSLKERQVYKKALKLLGVSSTGRRTKVTRRRRRFSVAQRQNMTVPTGKPTIS
GKLNLDASPVIGQDILLTLSLRNLITDFKTVKVKLSASAVLYTRKPKAEILQWSRSIQLG
SEEVKEIPFKISYSQYKNALMDDRKILVTALCEVRQGSSLLMEKDILLQDPFLTIKVFGP
TVVHKAANVQVTFTNPLSEMVTDCVLRAEGSGLLKEQLQINVARMAPMESSTTEFEIIPY
KSGTRQLQVDLVSNHFTDVKGFVMLDVTPVQ
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaggaacaacgttttcaattaacttgccttgcatctttctagccctgaaaata
acaaacatcaattggcaatccaagctaaataaagctgcacatcacacatctgattacagc
aacacagaagtaatcttgaggagaggacaggccttcaccatcagcctaagcttccgaaca
atagtgcagccttgggacaacttcacatttattgcgagcacagaatccttcaatgtagta
attgagatcatcactgactctggcttgtcacacacagctgtcattcagaattgctgtctc
ctgttccctctggcaggaccatctccagcagagtcacagcagaccaaggtcatatttaac
ctttctgaggaaggtgccagtggctggagtgcaactcaagagcacagtgagcatggctgc
atgaacttcacaatagtcagccctgccaatgctgtcattggacgatacaaactcaaactc
cagattgattctgggaacaaggtctcatcagcgctcctgggccagtttgtgttactcttc
aatccctggtgtccaaatgatgatgtctacatggctaatgaaaaggaccgacaggagtat
gttctgaatgatagtggaatcatatttcatggactggaaaaatatattcagcaagaagct
tggaattatggacagtttgaagaggatatccttgatatctctctggctatactggatcga
agcttgaaccaccgcaaagatccatccactgatgtatccaacagaaacagtcccatctat
gtgagcagggttattagtgctatggttaacagcaatgatgaaaagggagtagtggaaggg
aagtggaatggaaagtactgttcaggaaccaaccccttgcactggagtggaagcgtgacc
attcttcgaaagtggtacagagggagatacaaacccgtccggtatggccaatgctgggtc
tttgcaggagtaatgtgcacagttctgagatccttgggaatacctacccgtgttattaca
aactttaactctgcccatgataggaatataaacctgagtattgataaatacattgacgtt
tctggaaagaccctgcacttgactgaagacagcgtgtggaatttccatgtctggaatgaa
agctggtttattagaagagatcttggctctttttatgatggatggcaggttttggatgca
acaccccaggaaagaagcaaaggcatatttcagtgtggccctgcctccaccaaagccatt
aaggaaggggatgtgaacctggattatgacagttcatttgtgtttgcagcagtgaatgct
gactgtgttacttggattcactatagcaacaaaagaaaagagagaatttactccaatact
aggaagattggaaaatttatcagcaccaaagcagtgagcaccaactcccgggtggatgtc
actcataattacaaatatccagaaggatccttgaaagaaaggcaggtgtacaaaaaagca
ctgaagctgctcggtgtgagcagcactggaagaagaaccaaagttacaagacgtagaaga
cgattttcagtagcacagagacaaaatatgacagtgcccacaggaaaacctactatctca
gggaagctgaacctggatgcatctcctgtaatcggccaggatatcctccttaccttgtca
ctgaggaacttgatcacagatttcaagaccgtaaaggttaaactgagtgcttcagctgtt
ctctacacaagaaaaccaaaggcagagattttgcagtggtctaggtctattcaacttgga
tctgaagaagtgaaagaaattccattcaagatctcctactcccagtacaaaaatgctctg
atggatgacaggaagatcctagtgactgctctttgtgaagtcagacagggatcctcactt
ctaatggagaaggatattttacttcaggatccttttctcaccatcaaggtctttggtcca
acagtggtacacaaggctgctaatgtgcaggtcacatttaccaacccactgtctgaaatg
gtgacagactgtgtgctgagagcagaaggtagtggcttgctcaaagaacagctccaaatc
aatgtggcacgaatggcccccatggagtcctcaacaactgagtttgagatcattccctac
aagagtggcacaaggcagcttcaggtggacttggtttccaaccattttacagacgttaag
ggatttgtgatgcttgatgtgactcccgtccagtga

DBGET integrated database retrieval system