KEGG   Anser cygnoides domesticus (swan goose): 106047160Help
Entry
106047160         CDS       T04896                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106047160
Enzymes [BR:acyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     106047160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N DUF4958
Motif
Other DBs
NCBI-GeneID: 106047160
NCBI-ProteinID: XP_013053963
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MGQAATQPSTNWHLKENTRDHHTNKFSSKELIVRRGQAFVVTFNGIEQPEQNLTFIVETG
PKPSKQAKTQATFGISSTASKENWSAVLQSTSSNSASITISSPANAVIGRYKLSVQSTSS
GSSSPATLGTFVLLFNPWSSGDDVFMSNKAECEEYVLEEFGIIFAGNTHHINSFGWNFGQ
FQGDILNICLSMLDRSLNYRQDPATDVSHRNDPKYLGRVLSAMVNANDDQGVVLGNWSGN
YEGGKSPSSWTGSGEILQNWKKSGFRPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNHLERGADSVWNFHVWNESWFSRSDLGPSYSGWQILDATPQEE
SGGIYQCGPASRNAIKEGDIDLDYDCPFVFAEVNADCMYWNYDPATGKKTLIFSKSTTIG
QFISTKAVGRDDRVDVTSDYKYEEGSRKERDIFKKARKKLGLEDKFDPTAPTPKEIEQKP
DISGKFKVAGPLEVGKDLNLILVLVNLQSDVKSVHVNMTAWSTVYTRRPVREIWKDSISV
TLSPEEEKHFPIKISYAEYQQQLTTDNTIQITALCHVEGGIQVLVQRDITLDNPAIDIQV
LGEAKVNKEVDVEVVFTNPINTEVMDCVLQVEGNDLLRGILEIDVPPLKAGEKSSTKFKL
IPVEMGSKHLLVNFSCDKFSNIKAFKTVNVID
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagctgcaacgcagccgagtaccaattggcacctgaaagaaaatacaagagat
caccacacaaataaattttcgagcaaagagttgattgtgaggagaggtcaagcctttgtt
gtcaccttcaatggaattgaacagcctgagcaaaacttaacattcatcgtagaaacaggt
ccaaaaccctcaaagcaggctaagacccaggccacatttggtatttccagcacagcgagt
aaggagaattggagtgcagttctgcagtccaccagttccaactctgcaagcatcaccatt
tccagcccagctaatgctgtcatcggacgttacaagctgagtgttcaaagtacttcgagt
ggcagctcatctccagcaacccttggcacttttgttttgctctttaatccttggtcttca
ggtgatgatgtgttcatgtctaacaaggctgagtgtgaggaatatgtgctagaagagttt
ggcatcatttttgctggcaatacacatcatatcaacagctttggatggaactttggccag
tttcaaggagatattctcaatatttgcctttccatgctggatcgaagcttaaactaccgt
caggatcctgccacagatgtatctcaccgaaatgatcccaaatatctgggccgagttctc
agcgcaatggtcaacgccaatgatgaccaaggagtggtactaggaaactggagtggaaat
tatgaaggtgggaaaagtccaagcagctggactggaagtggtgaaatcctgcaaaactgg
aagaaatcaggattcaggcctgttagatatggacaatgttgggtttttgcagcagtattg
accacagtgcttagatgtctggggattcccactcgtacaattacaaacttcagctctgcc
cacgatgcagatggaaacctgcgtgtggatgagttttacgatgcttctggaaatcatttg
gagagaggagctgacagtgtctggaatttccatgtctggaatgaaagctggttttcccgc
agtgacttgggcccctcatacagtggatggcaaatcctggatgcaactccccaagaagaa
agtggaggaatttatcagtgtggtcctgcctcacggaatgccatcaaagaaggagacata
gatttggactacgattgcccatttgtatttgcagaagtgaatgcagactgtatgtactgg
aattatgaccctgcaactggaaagaaaacattaatattctctaagtctacaacaattggc
cagttcatcagcacaaaggcagttggtagagatgatcgtgtagatgtcaccagtgattat
aaatatgaggaaggctctagaaaagaaagagatatttttaaaaaagcccgtaagaagctg
ggacttgaagataaatttgatcctacagcaccgacaccaaaggaaattgaacaaaagcct
gatatctcagggaagttcaaagtggctggtcctttagaagttggcaaagatctcaatcta
attctggttcttgtaaatttacaatctgatgttaagtctgttcatgtaaatatgactgcc
tggagcactgtgtacactagaagaccagttcgtgagatctggaaggactccatatctgtc
actctgtctcctgaggaagagaaacattttcccattaagatatcttacgctgaatatcaa
cagcagttaactacagacaacacaattcaaataacagcgttatgtcatgtagaaggtgga
attcaagtactagtgcaaagagacattaccctggacaatcctgctatcgacatacaggta
cttggtgaagcaaaagtgaataaagaagttgatgtagaagtggtatttaccaatcctatt
aatacagaagtgatggactgtgtgctgcaggtagaaggcaatgacctgctgagaggaatc
cttgagatagacgtaccaccactgaaagctggtgagaaatccagtacaaagtttaaactt
attcctgtcgagatgggttccaagcatctacttgttaatttctcctgtgataaattttca
aatatcaaggcctttaagactgtaaatgtgattgactaa

DBGET integrated database retrieval system