KEGG   Anser cygnoides domesticus (swan goose): 106047231Help
Entry
106047231         CDS       T04896                                 

Gene name
PARK7
Definition
(RefSeq) protein deglycase DJ-1 isoform X1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acyg01002]
    106047231 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acyg04147]
    106047231 (PARK7)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     106047231 (PARK7)
Peptidases [BR:acyg01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   106047231 (PARK7)
Exosome [BR:acyg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106047231 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 106047231
NCBI-ProteinID: XP_013054049
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLTGKDPVQCSRDVFICPDASLED
ARKEGPYDVIVLPGGNLGAQNLSESSAVKDVLKDQESRKGLIAAICAGPTALLAHGIGFG
SKVTTHPLAKDKMMNGAHYCYSESRVEKDGNILTSRGPGTSFEFGLAIVETLMGKEVAEQ
VKAPLILKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaaaagagcattggtaattctggcaaaaggggcagaggaaatggaaactgta
atccccactgatgttatgagaagagctgggatcaaggtgacggttgcaggcctaacagga
aaagatccagtgcagtgcagtcgagatgtcttcatttgtcctgatgccagtctagaagat
gccagaaaagaggggccttacgatgtcattgtcctgcctggaggcaaccttggtgctcaa
aacttgtcagagtcttctgctgttaaagacgttttgaaggatcaggaaagcagaaaaggc
ctgatagctgctatatgcgcaggtcctactgcccttctggcacatgggatagggtttgga
agcaaagtcacaacgcatcctttggccaaagataaaatgatgaatggagctcactactgc
tactccgagagccgcgtggagaaagatgggaacatcctcaccagccgtggccctggtacc
agctttgagtttgggttggccattgttgaaacactgatggggaaggaagtggctgaacag
gtgaaggcacccctaatactgaaagagtga

DBGET integrated database retrieval system