KEGG   Anser cygnoides domesticus (swan goose): 106047781
Entry
106047781         CDS       T04896                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04010  MAPK signaling pathway
acyg04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106047781 (CACNA1E)
   04020 Calcium signaling pathway
    106047781 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acyg04040]
    106047781 (CACNA1E)
Ion channels [BR:acyg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106047781 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 106047781
NCBI-ProteinID: XP_013054873
LinkDB
Position
Unknown
AA seq 2285 aa
MLGLGTCSVSAPGRGAELAAPPRSLLALPEEETWRKHRLGLMQSTQSCNLLEPQSLAEAL
VSRAASFDALYQPRDGDGGSALDLGQYVPVSPDVIKRRRGGLIEQRDIIKAHEAHKMQST
PQARRKEWEMARFGEAVAGRLGSGDGGSEQNRSRQGAPAPAGGTPGAFKQTKAQRARTMA
LYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQH
LPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSG
ILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFA
ILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQ
FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS
GEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLR
RATIKRNRTDTMNRDSSDEHCVDIASVGERRLAQRRPLHPTLGNPLSRSGLKGARVDGAS
YLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFL
GLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRL
LRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFIDGTP
SANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLN
VFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHM
SMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKK
PGDGVALEKCDEEQGGKGERPPAEGPEPPAPGTKPGSGEDRRSPSPRARRDKELWHQKAC
HGNCEPGEEGAGGGIEERARMRQSQRRSRHRKARMEGKDPALGSRSGSQEMGLEEASPTE
GAQDGDRRGDAAAVGESCSPRNSSSHCFPLIFLHLFVLPSHRTNGVLAEEGSPPAAAPEP
PRGLEGSLGEQDCSSPDTSEQALLGGASLGASRTVSRSEPDLSSVTANTEKATESTAIMI
DVQESAVVQISNKTDGEASPLKEAESKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFST
TNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALATNKGRDIKTIKSLRVLRV
LRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSS
KDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSV
DVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKN
ERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSA
PYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDT
KARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESH
INRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLA
YVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRI
SYKDMYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDI
KIAKGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYK
QSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGFPSLS
PLSPQEIFQLACMDPAHGQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASS
MPRLTVEPQVVTDTSSMRRSFSTIRDKRTNTSWLDEFSMERSSDNTYKSRRRSYHSSLQL
SARRLNADSGHRSDGHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAHDESPERRRES
RSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRQL
AARSI
NT seq 6858 nt   +upstreamnt  +downstreamnt
atgctcggactcggcacgtgctccgtcagcgccccgggcaggggggctgagctggccgcc
cccccccgctccctcctggccctgcccgaggaggagacgtggcgcaagcaccggctcggc
ctgatgcagagcacccagtcctgcaacctgctggagccccagagcctggccgaggcgctg
gtgtcgcgtgccgccagcttcgatgccctctaccagccccgggatggcgacggcggcagc
gccctggacctggggcagtacgtccccgtcagcccggacgtcatcaagcgccgtcggggc
gggctgatcgagcagagggacatcatcaaggcgcacgaggcgcacaagatgcagagcacg
ccgcaggcacggaggaaggagtgggagatggctcgcttcggggaggcggtggccggcagg
cttggctccggagatgggggctccgagcagaaccggagccggcaaggagctcctgcccct
gcgggagggaccccgggagccttcaagcaaaccaaagcgcagcgagcccggactatggct
ctgtacaaccccatccccgtccggcagaactgcttcaccgtcaacagatccttgttcctc
tttggggaagagaacatagtcaggaaatacgccaagaagctcatcgactggccgcccttc
gagtacatgatcctggccaccatcatcgccaactgcatcgtgctggccctggagcagcac
ctccccgaggacgacaagacgcccatgtcgcggagactggagaagacggagccgtacttc
atcgggattttctgcttcgaggctgggattaagattgtggctctgggcttcgtgttccac
aagggctcctacctgcgcaacggctggaatgtgatggacttcatcgtggtcctcagcggc
atcctcgccacggccgggacgcatttcaacacgcacgtggacctgcgcaccctgcgcgcc
gtacgcgtcctcaggcccctgaagctcgtctcgggcattcccagcctgcagatcgtgctg
aagtccatcatgaaggccatggtgcctctcctccagatcggcttgctgctctttttcgcc
attctcatgtttgccatcatcggcctggagttctacagcgggaagctgcaccgagcctgc
tacacgaacaattcaggtgagctggaggagctggaccccccccacccgtgcggggtgcag
ggttgccccccgggctacgagtgccgggagtggatcggtcccaacgacgggatcacgcag
ttcgacaacatcctcttcgctgtgctgaccgtcttccagtgcatcaccatggaagggtgg
accacagtcctgtacaacaccaatgatgccttaggagccacctggaactggctgtacttc
atccccctcatcatcattggatccttcttcgtcctcaaccttgtcctgggagtgctgtcg
ggggagtttgccaaagagcgcgagcgcgtggagaaccgccgagccttcatgaagctgcgg
cgccagcagcagatcgagcgggagctcaacggctaccgggcctggatagacaaagcggag
gaagtcatgctggctgaagagaacaaaaattccgggacctcagccttagaagtgctcagg
cgagccaccatcaaaaggaaccggacggacaccatgaaccgcgactccagcgatgagcac
tgcgtcgacatcgcctcggtgggcgagcggaggctggcgcagagaagacctctccatccc
accctgggtaaccccttgagccgctcgggcctgaaaggcgccagggtggacggtgcctcc
tatctgcggcacaaggagcgcctcctgcgcatctccgtccgccacatggtgaaatcccag
gtcttctactggatcgtcctgagcctggtagccctcaacaccgcctgcgtggccatcgtg
catcacaaccagccggcctggctcacacacttcctctactatgcagagttcctgtttctt
gggctcttcctcctggagatgtccttaaagatgtatggcatggggccacgcctgtacttc
cattcttcattcaactgcttcgactgtggggtcacggtgggaagcatctttgaagtggtt
tgggccatcttcagaccaggaacctcctttgggatcagtgtcctacgagcccttcgtctc
ctacgaatatttaaaataaccaagtactgggcatccttgaggaatttggtggtctctctg
atgagctccatgaagtctattatcagcctgctcttcctcctcttcctcttcattgtggtc
ttcgctctgctgggcatgcagctgttcggaggcaggtttaacttcatcgacgggacgccg
tcagccaacttcgacactttccccgcagccatcatgacggtgttccagatcctgacgggc
gaggactggaacgaggtgatgtacaacggcatccgctcgcagggaggcgttcgctcgggc
atgtggtcctccatctacttcatcgtcctcaccctgttcggaaactatactctgctgaac
gtcttcttggccatcgcggtggacaacctggccaacgctcaggagctcaccaaggacgag
caggaggaagaggaggcctttaaccagaagcatgcccttcagaaagccaaggaagtcagc
cccatgtccgcccccaacatgccggctatcgaaagagacaggcgcaggagacaccacatg
tcgatgtgggagccgcgcagcagccacctgcgggagcggcgccggcggcaccacatgtcg
gtgtgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggagggc
atcaacaaggacgagcccccgctcatcaacccccacgccagcatcttccgacgcaagaaa
ccgggcgacggcgtcgccttggagaagtgcgacgaggagcagggcggcaagggcgagcgg
ccgccggctgagggtcccgagccgccggccccggggaccaagccgggcagcggggaggac
aggaggagcccatcgccccgggccaggcgggacaaggagctgtggcaccagaaagcgtgc
catgggaactgtgagccgggcgaggaaggggcaggaggaggcatcgaggagagggcgcgg
atgaggcagagccagcggcgcagccggcaccggaaagccaggatggaggggaaggatccg
gccctggggagccgctcgggcagccaggagatggggctggaggaggccagccccacagag
ggggcgcaggatggggaccggcgcggggatgctgccgcggttggggaatcttgtagcccc
cgtaactcctcgagtcattgctttccacttatcttcttgcacctttttgtccttccctcc
cacaggactaacggggtccttgctgaggaggggagccccccggcagcggcacccgagccc
ccccgggggctggagggcagcctgggcgagcaggactgcagcagcccagacaccagcgag
caagccctgctggggggagcgtcgctgggggccagccgcaccgtcagccgcagcgagccc
gacctctcctccgtcaccgccaacaccgagaaggccaccgagagcaccgccatcatgatc
gatgtccaagagtccgctgtggtacagattagcaacaagactgatggggaagccagcccc
ctgaaggaggcagagagcaaggaggacgaggaggagatggagaagaagaagcggaagaag
gagaagagcgagacaggcaaagcgatggtgccgcacagctccatgttcatcttcagcacc
acgaacccggtgcgcagagcctgccactacatcgtgaacctgcgctacttcgagatgtgc
atcctcctggtcatcgccgccagcagcatcgccctcgcggccgaggatcccgtcctcacc
aattctgaccgtaacaaggtcctgaggtattttgactacgttttcacgggggtgttcacc
ttcgagatggttatcaagatgatcgaccagggcttgatcctgcaggacggctcctacttc
cgagacctctggaacatcctggacttcatcgtggtggtgggagctctggtggctttcgcc
ttggcgaccaacaagggccgggatatcaagaccatcaagtccctccgtgtgctgcgggtc
ctgaggcccctgaaaaccatcaagcggctgcccaagctgaaggccgtcttcgactgcgtc
gtgacgtccctcaagaacgtgttcaacatcctcatcgtctacaagctcttcatgttcatc
tttgccgtcattgccgtccagctcttcaaggggaagttcttctactgcactgacagctct
aaggacacggagaaggactgcatagggaactacgtggaccacgagaagaacaagatggag
gtgaagtgccgggagtggaaacgacacgagtttcactacgacaacataatctgggcattg
ctcaccctgttcacagtctccaccggcgagggttggccccaggtgctgcagcattcggtg
gacgtgacggaggaggaccgcgggcccagccgcagcaaccgcatggagatgtccattttt
tatgtcgtctactttgtggtctttccattcttctttgtcaacattttcgtggctctcatc
atcatcacctttcaagagcaaggagacaaaatgatggaggagtgcagtctggagaagaac
gagagagcctgtattgactttgccatcagtgccaagcccctcacgcgctacatgccccag
aaccggcacaccttccagtaccgggtctggcactttgtggtctccccgtccttcgagtac
accatcatggccatgatcgcgttgaacaccgtggtgctgatgatgaagtactactctgct
ccgtacacctacgagctggcactgaagtacctgaacattgcgttcaccatggtcttctcc
ttggagtgcgtcctcaagatcattgctttcggcttcctgaattatttccgggacacctgg
aacatctttgacttcatcaccgtcatcggcagcatcacggagatcatcctgacggacacc
aaggctcggctcatcaagctgctgcgccagggttacaccatccgcatcctgctctggacg
ttcgtgcagtccttcaaggccctcccctacgtctgcctcctgatcgcgatgcttttcttc
atctacgccatcatcgggatgcaggtttttggcaacatcaagctggatgaggaaagccac
attaaccggcacaacaacttccgcagctttctgggctccctcatgctcctcttcaggagt
gccaccggggaggcatggcaggagatcatgctgtcctgcctggagggcaagggctgcgag
ccggatacgacggcaacgtccgggcagaacgagaatgagcgctgcggcaccgacctggcc
tacgtttacttcgtctccttcatcttcttctgctcgttcctgatgctcaatctgttcgtg
gccgtcatcatggacaacttcgaatacctgacccgcgattcctccatcctgggacctcac
catctggatgagtttgtccggatctgggcagagtatgacagagcagcgtgcggcaggatc
tcgtataaggatatgtacaaattagtacgggtgatctcgcctcctctgggcctaggagag
aactgcccctacagggtggcgtgcaagagactggtgctgatgaacatgcccgtggccgag
gacatgacggtccacttcacctccaccctgatggcgctgatacgcaccgccctggacatc
aaaatcgccaaaggtggtgcagactggcagcagttagactccgagcttcaaaaggagatc
ctgaccatttggcctcacctgtcgcagaagatgctcgacctgttggtacccatgccaaaa
acctctgacctgactgttggcaaaatctacgcagccatgatgatcatggactactacaag
cagagcaaagcgaagaagcagaggcagcagctggaggagcagaaaaacgcgcccatgttc
cagcgcatggagccctcctctctgccgcaggaaatcatctcaaacgcgaaggctctgcct
tacctccagcaggacaccctctcgggcctgagcagccggagcgggttcccctcgctgagc
ccgctctcgccgcaggagatcttccagctggcgtgcatggatccagcccacgggcagttc
caggagcaccagtctctggagccagaggttagggagtttcaaagagtgcagccctctaac
cgtggcagctaccttcccgtggacactcaggaccacgctgtatctgggagggcctcctcc
atgcctcgtctcactgtggaaccccaggtggtgacggacaccagctcgatgcggcggtcg
ttttccaccatccgggacaagcgcaccaacacctcctggctggacgagttctccatggag
cgcagcagcgacaacacctacaagtcccgccggcgcagctaccactcctcgctccagctc
tctgcccggcgcctcaacgctgactcgggccacaggtccgacgggcaccgctcgggcggc
agggagcggggccgatccaaagagcgcaagcacttgctgtcccccgacatctcccgctgc
aattcggaggagaggagtccccaggcgcacgacgagtccccggagcggcggcgcgagtcc
cggtcacccagcgagggcaggtcacagacacccaacaggcagggaacgggctcgctgagc
gaaagctccatcccctccatctcggacaccagcacgccccggcgaggccgccgccagctc
cccccggtgccccccaaaccgcgtcccctcctctcctacgcctccatgctgcggcaactg
gcagcaagaagcatttga

DBGET integrated database retrieval system