KEGG   Anser cygnoides domesticus (swan goose): 106048026
Entry
106048026         CDS       T04896                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04068  FoxO signaling pathway
acyg04217  Necroptosis
acyg04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106048026 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106048026 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106048026 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acyg03000]
    106048026 (STAT3)
Transcription factors [BR:acyg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106048026 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 SprA-related Baculo_PEP_C Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 106048026
NCBI-ProteinID: XP_013055258
LinkDB
Position
Unknown
AA seq 768 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQVRRELPVRFSLGRGCPAAPRAQLANLLFA
SQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQG
DMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEELADW
KRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRP
MLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLK
IKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGR
ANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNML
TNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQ
ITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPP
GTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIMDAT
NILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGAAPYLKTKFICVTPTSFSNTID
LPMSPRTLDSLMQFGNSSEGAEANAGGQFGEPGGGTQHPGAAWRRLEP
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcgctacctggagcagctccaccag
ctctacagcgacagcttccccatggagctgcggcagttcctggccccgtggattgagagc
caggactgggcgtacgccgccaacaaggagtctcacgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgcttcctgcaggagtccaacgtcctgtaccag
cacaacctgcggcgcatcaagcagttcctgcaggtgaggcgggagctccccgttcggttt
tccctcgggcgcgggtgcccggcggctccccgggcacagctcgcaaaccttctgttcgcg
agccaaggagggcaggcgacgcatccgacagcagccgtggtgacagaaaagcagcagatg
ctggagcagcacctgcaggatgtgaggaagagggtgcaggatctggagcagaagatgaaa
gtggtggagaatctccaggatgactttgattttaactacaagactttgaaaagccaaggg
gacatgcaggatctgaacgggaacaatcagtcggtgacgcggcagaagatgcagcagctg
gagcagatgctcaccgcgctggaccagatgcgaaggggtatcgtaagcgagctggctggc
ctgctgtcagccatggagtacgtgcagaagatgctggcagacgaggagctggcagactgg
aagagacggcagcaaattgcttgcatcggtggcccaccaaatatctgcttagaccggctt
gagaactggataacctctctcgccgaatcgcagctacagacccggcagcagatcaagaag
ctggaagagctgcaacagaaagtgtcctacaagggcgaccccatcgtccagcaccggccc
atgctggaggagcggatcgtggagctcttcaggaacctgatgaaaagcgccttcgtggtg
gagaggcagccctgcatgcccatgcatcccgaccggcccctggtcatcaaaaccggcgtg
cagttcaccaccaaagtcaggttgttggtgaagtttccagagctgaattaccagctgaaa
atcaaagtctgcatcgacaaggactctggtgatgtcgcagcactgcgggggtcccggaag
tttaacatcctggggacaaacaccaaggtcatgaacatggaggagtccaacaacggcagc
ctctcggcggagttcaagcacctgaccctgcgggagcagcggtgcgggaacggaggtcga
gccaactgcgatgcctcgctgattgtgaccgaggagctgcacctcatcaccttcgagacg
gaggtgtatcaccaggggctgaagatcgacctggagacccactcgctgcccgtggtggtc
atctcgaacatctgccagatgcccaatgcctgggcgtccatcctgtggtacaacatgctg
accaacaaccccaagaacgtcaacttcttcaccaagccccccatcgggacgtgggaccag
gtggcggaggtgctgagctggcagttctcctccaccaccaagcgaggcctcagcatcgag
cagctgacgacgctggcagaaaaacttctcgggccaggcgtgaattactcgggctgtcag
atcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctcgttttgggtc
tggctggacaacatcattgacctggtgaagaaatacatcctggcgctgtggaacgaaggg
tacatcatgggcttcatcagcaaggagcgggagcgagccatcctgagcaccaagcctccg
ggcaccttcctgctgcgcttcagcgagagcagcaaggagggcggcatcaccttcacctgg
gtggagaaggacatcagcgggaaaacccagatccagtccgtggagccttacaccaagcag
cagctgaacagcatgtcgttcgccgagatcatcatgggctacaagatcatggacgccacc
aacatcctggtgtcccccctggtgtacctgtacccggacatccccaaggaggaggcgttc
gggaagtactgccgctccgagagccaggagcactcggaagctaccgactcaggtgctgct
ccctatctaaagaccaagttcatctgtgtcacccccacctccttcagcaacaccatcgac
ctgcccatgtccccgcgcaccctggactcgctcatgcagttcggcaacagcagcgagggg
gccgaggccaacgcgggcggccagttcggtgagcctgggggggggacccagcacccgggg
gcagcctggcggcggctggagccttga

DBGET integrated database retrieval system