KEGG   Anser cygnoides domesticus (swan goose): 106048916Help
Entry
106048916         CDS       T04896                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00010  Glycolysis / Gluconeogenesis
acyg00051  Fructose and mannose metabolism
acyg00052  Galactose metabolism
acyg00500  Starch and sucrose metabolism
acyg00520  Amino sugar and nucleotide sugar metabolism
acyg01100  Metabolic pathways
acyg01200  Carbon metabolism
acyg04910  Insulin signaling pathway
Module
acyg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acyg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106048916 (GCK)
   00051 Fructose and mannose metabolism
    106048916 (GCK)
   00052 Galactose metabolism
    106048916 (GCK)
   00500 Starch and sucrose metabolism
    106048916 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    106048916 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106048916 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106048916 (GCK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acyg04131]
    106048916 (GCK)
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106048916 (GCK)
Membrane trafficking [BR:acyg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106048916 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106048916
NCBI-ProteinID: XP_013056481
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MVRACRQVDKYLYHMRLSEETLQEVSERFRKEMEKGLGADTNPTASVKMLPSFVRSTPDG
TEDGDFLALDLGGTNFRVLRVKVSDNGLQKVEMESQIYEIHEDLMRGSGGQLFDHIAECL
ANFMEKLKIKDKKLPLGFTFSFPCHQTKLDESILVTWTKGFKCSSVEGKDVVSLLRKAIK
KRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEVGLIVGTGTNACYMEEMRHIDLVEGDEGR
MCINMEWGAFGDDGVLNDIRTEFDHEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMA
KEGLLFRGKLTSDLRTTGHFETRYVSAIEKEKEGLQKAHEILTKLGLEPSHEDCLATHRI
CQIVSTRSANLCGATLAAVLRRIKENKGVDRLRSTVGVDGSVYKKHPHFARRLHKTVRKL
LPDCEIRFVRSEDGSGKGAAMVTAVAYRLAAQHKARQKILEALKLSHEQLLEVKRRMRVE
MEKGLGKETHAKATVKMLPTYVCSTPDGTEKGDFLALDLGGTNFRVLLVRVRNGMRRGVE
MHNKIYSIPLEIMQGTGEELFDHIVHCISDFLEYMGMKGVSLPLGFTFSFPCKQTSLDEG
ILLKWTKGFKATGCEGEDVVSLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPYCEV
GLIVGTGSNACYMEEMRNVELVEGDEGRMCINMEWGAFGDSGCLDDIRTEFDLAVDELSL
NPGKQRFEKMISGMYLGEIVRNILMDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDC
LALLQVRSILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDFL
KVTVGVDGTLYKLHPHFSTVMHETVKQLSPKCEVTFLQSEDGSGKGAALITAVACRIREA
GQR
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtgcctgcagacaggtggacaagtacctctaccacatgcggctctccgaggag
accctccaggaggtgtccgagcgcttccgcaaggagatggagaaagggctgggagctgac
accaaccccaccgcctcggtgaagatgctgccctccttcgtgaggtccaccccggacggc
acagaggacggcgacttcttggcgctggacctcggcggcaccaacttccgcgtgctgcgg
gtgaaggtgtccgacaatggcctgcagaaagtggagatggagagccagatctacgaaatc
cacgaggacctcatgcgaggcagcggggggcagctcttcgaccacatcgccgagtgcctg
gccaacttcatggagaagctgaaaatcaaggacaagaagctgccccttggcttcaccttc
tctttcccgtgtcaccagaccaagctggatgagagcatcctcgtcacctggacaaagggt
ttcaagtgcagcagcgtggaggggaaggacgtggtgtccctgctgcgcaaggccatcaag
aagcgaggggactttgacatagacatcgtggccgtggtgaacgacaccgtgggcaccatg
atgacctgtggctacgacgaccacaactgcgaagttggactcattgtcggtactggcacc
aacgcctgctacatggaggagatgaggcacatcgacctggtggagggggacgagggcagg
atgtgcatcaacatggagtggggcgccttcggcgacgacggcgtgctcaacgacatcagg
acggagttcgaccacgagatcgacatgggctcgctcaaccccggcaagcagctgtttgag
aagatgatcagcggcatgtacatgggagagctggtccggctcatcctggtcaagatggcc
aaggaggggctcttgttcagggggaagctcacatcagacctgcgcactaccggccacttc
gagaccagatacgtctccgctatcgagaaggagaaagaagggctgcagaaagcccacgag
atcctcaccaagctgggtctggagccatcccacgaggactgcctggccacccaccgcatc
tgccagatcgtctccacccgctcagccaacctgtgcggggccaccctggctgccgtgctg
cggcgcatcaaggagaacaagggggtggaccggctgcgctccacggtcggcgtggacggc
tccgtctacaagaagcatccccactttgcccggcgcctccataagacggtgcggaagctg
ctgcccgactgcgagatccgctttgtgaggtcggaagacggcagcggcaagggggcagcc
atggtgacggccgtggcctacaggctggccgcccagcacaaggcaaggcagaagatcttg
gaggcgctcaaactgagccacgagcagctcctggaggtgaagcggaggatgagggtggag
atggagaaggggctaggcaaggagacgcacgccaaggccacggtgaagatgctgcccacc
tacgtgtgctcgactccggatgggacagagaaaggtgatttcctcgccctggacctgggg
ggcacaaacttccgtgtgctgctggtgcgcgtgcggaatgggatgaggcgcggcgtggag
atgcacaacaagatctactccatcccgctggagatcatgcaggggacgggcgaggagctc
ttcgaccacattgtccactgcatctccgacttcctggagtacatgggaatgaagggcgtt
tcgctcccgctggggttcaccttctccttcccttgcaagcagaccagcctggatgagggg
attctcctcaagtggacaaaaggcttcaaagcgaccggctgcgagggagaggatgtggtg
agcctgctgaaggaggcgatccacaggagagaggagttcgacctggatgtggtggcggtg
gtaaatgacacggtcggcaccatgatgacatgtggctatgaagatccgtactgtgaagtg
gggctgatagtcggcacaggcagcaatgcctgctacatggaggagatgaggaatgtggag
ctggtggaaggcgacgagggcaggatgtgcatcaacatggagtggggcgcctttggtgac
agtgggtgtctggatgacatacggacagagtttgacttggccgtggatgagctgtctctc
aaccctgggaaacaaaggtttgagaagatgatcagcgggatgtacctgggggagatcgta
cggaacatcctgatggacttcaccaagcgagggctgctcttccgcggacggatctccgag
aggctgaagaccagagggatctttgagactaagttcctgtcccagatagaaagcgactgc
ctggccctgctgcaagtgcgctccatcctccagcacctgggcctggagagcacgtgcgat
gacagcatcattgtgaaggaggtgtgcacggtggtggcccggcgcgccgcccagctctgc
ggggccggcatggcagccgtggtggacaagatcagggagaaccgtggcttggacttcctc
aaggtgacggtcggcgtggacggcacgctctacaagctgcacccacacttctccaccgtc
atgcatgagacagtgaagcagctgtcccccaagtgcgaggtgaccttcctgcagtcagag
gacggcagcggcaagggtgcggcgctcatcacagcggtggcttgccgcatccgggaggcc
ggccagcggtag

DBGET integrated database retrieval system