KEGG   Anser cygnoides domesticus (swan goose): 106049475
Entry
106049475         CDS       T04896                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04080  Neuroactive ligand-receptor interaction
acyg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106049475 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106049475 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:acyg04030]
    106049475 (LPAR2)
G protein-coupled receptors [BR:acyg04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    106049475 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 106049475
NCBI-ProteinID: XP_013057267
LinkDB
Position
Unknown
AA seq 361 aa
MLNVRFGCSGCASRTAAMKHCFYNETVGFFYNNSRKELTTYWRTKDVLVVALGLTVSVIV
LLTNLLVITAIIINRRFHYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTWFI
RQSLLDTSLTASVVNLLAIAVERHQTVFTMQLHSKMSNQRVMILIFCIWVTALLLGLIPS
YGWHCLCALEKCSSMAPLYSRSYLTFWAISNLVIFLIMVVVYTHIFIYVKRKMTRMSKHT
SFHPRYKETMISLVKTVTIILSAFVICWTPGQVVLLLDGLGCKSCNVLAVEKYVLLLAEI
NSLINAIVYSYRDNEMRSTFRRILCFICYRNSKYTPTVVKLNTTDRRTLSQNGHFTVDSS
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgctaaatgtcaggtttggatgcagtggttgtgcctccaggacagcagcgatgaagcac
tgcttttacaatgagacggtggggttcttctacaacaacagccgcaaggagctgaccacg
tactggaggacgaaggacgtcctggtggttgccctgggcctgacggtgagcgtcatcgtg
ctgctgaccaacctgctggtcatcaccgccatcatcatcaaccgccgcttccactacccc
atctactacctgctgggcaacttggcagctgctgacctcttcgctggcatcgcctacatg
ttcctcatgttccacacggggcccaggactgcagagctctccctgaagacctggttcatc
cgtcagagcctgctggacaccagcctgaccgcctccgtggtgaacctgctggcaatcgcg
gtggagaggcaccagactgttttcaccatgcaactgcacagcaaaatgtccaaccagcgc
gtgatgatcctcatcttctgcatctgggtcacggccctgctgctggggctcatcccgtcc
tacggctggcactgcctctgtgccctggagaagtgctccagcatggcgccgctctacagc
aggagctacctgaccttctgggccatctccaacctggtcatcttcctcatcatggtggtc
gtgtacacgcacatcttcatctacgtgaagaggaagatgacgcggatgtccaagcacacc
agcttccacccccgctacaaggagaccatgatcagcctcgtcaagacggtcacaattatc
ctaagtgcttttgttatctgctggactccaggacaagttgtgctcctgctggatggcttg
ggctgcaagagctgcaatgttctcgcggtggagaaatacgtccttttgctggcagagatc
aattcgttgataaacgctattgtctactcttacagggacaacgagatgcgtagcacgttc
cggaggatcctctgcttcatctgttataggaattccaaatacacacccacggtggtgaag
ttaaacaccacagaccgcagaacactttctcagaacgggcactttaccgtggactcctct
atttag

DBGET integrated database retrieval system