KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_c0909Help
Entry
Acaty_c0909       CDS       T03561                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00630  Glyoxylate and dicarboxylate metabolism
acz00710  Carbon fixation in photosynthetic organisms
acz01100  Metabolic pathways
acz01120  Microbial metabolism in diverse environments
acz01200  Carbon metabolism
Module
acz_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acaty_c0909
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acaty_c0909
Enzymes [BR:acz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Acaty_c0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Peptidase_C39_2
Motif
Other DBs
NCBI-ProteinID: AIA54785
UniProt: A0A059ZT68
LinkDB All DBs
Position
901411..901743
Genome map
AA seq 110 aa AA seqDB search
MAEVQEYKQVRRYETFSYLPPFSAEQVRAQIQYIIAQGWNPAVEHIEPNRPFTYYWYMWK
LPMFGERNVDAVLAELEACRREYPNHLIRLIGYDNYTQSQGLSFVVYRGS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgcaagaatacaagcaggtccggcggtatgagaccttttcgtacctgccg
cccttttccgcggagcaggtgcgggcccagatccagtacatcatcgcccagggctggaat
ccggcggtggaacacatcgagcccaaccgtccctttacctactactggtacatgtggaag
ctgccgatgttcggcgagcgcaatgtcgatgccgtcctggcggagttggaggcctgccgg
cgcgagtacccgaaccacctgatccgtctcatcggttacgacaattacacccagagtcag
ggtttgtctttcgtcgtctatcgcggttcctga

DBGET integrated database retrieval system