KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_c0909Help
Entry
Acaty_c0909       CDS       T03561                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00710  Carbon fixation in photosynthetic organisms
acz01100  Metabolic pathways
acz01120  Microbial metabolism in diverse environments
acz01200  Carbon metabolism
Module
acz_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acaty_c0909
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acaty_c0909
Enzymes [BR:acz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Acaty_c0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Peptidase_C39_2
Motif
Other DBs
NCBI-ProteinID: AIA54785
UniProt: A0A059ZT68
LinkDB All DBs
Position
901411..901743
Genome map
AA seq 110 aa AA seqDB search
MAEVQEYKQVRRYETFSYLPPFSAEQVRAQIQYIIAQGWNPAVEHIEPNRPFTYYWYMWK
LPMFGERNVDAVLAELEACRREYPNHLIRLIGYDNYTQSQGLSFVVYRGS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgcaagaatacaagcaggtccggcggtatgagaccttttcgtacctgccg
cccttttccgcggagcaggtgcgggcccagatccagtacatcatcgcccagggctggaat
ccggcggtggaacacatcgagcccaaccgtccctttacctactactggtacatgtggaag
ctgccgatgttcggcgagcgcaatgtcgatgccgtcctggcggagttggaggcctgccgg
cgcgagtacccgaaccacctgatccgtctcatcggttacgacaattacacccagagtcag
ggtttgtctttcgtcgtctatcgcggttcctga

DBGET integrated database retrieval system