KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_c1210Help
Entry
Acaty_c1210       CDS       T03561                                 

Definition
(GenBank) Glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00500  Starch and sucrose metabolism
acz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acaty_c1210
Enzymes [BR:acz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Acaty_c1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AIA55078
UniProt: A0A059ZUD2
LinkDB All DBs
Position
1216248..1218644
Genome map
AA seq 798 aa AA seqDB search
MATEEVPMSATEPAPHAQSSHPVWATAQKSLVGTALGPSRLWFTIGRGIVTEVFYPRIDV
PAIRDLGFLISDGDGFWLEIKTNPNWNQSLADSQVPLPVIEHLHERFRLRFSVVADPKRD
VLLLDYDLEAEPSLQCFALCAARLGGDATANRAWTGEWEGRELLWAEQGPFGLALLCRDA
EGKPAYGRRSVGEVGASDLWQDFAQHSGVMTWHYDAAGPGEVAMAGELPHRGTLALGLGT
SKEAAATNAWASLTQGFAEIREQYQGAWLQWHSMHKTPRGFRRRFSPAMQNLYRRSKNVL
KVHADRTFPGALVASLSVPWGEASSSRGGYHLVWSRDLVESAGAALAAGMVEEAREVLCY
LISTQQADGHWLQNQWLGGKPFWQGIQLDEAGFPVILAALLRDQGALGEILVDDMVRRAL
AFILREGPTTGQDRWEEDAGVNPFTLAVVIAALIEGAEFLGGKAGACAQMVADYWNARLE
DWTFVRDTELARVHGVRGYYLRIAPEDILVQDGAKDEWVQIKNRAHDPHLPASEQVATDF
LQLVRFGLRTADDPHIVDSVKVMDAVLRCDTPNGPVWHRYNGDGYGEHADGSPFDGTGIG
RGWPLLVGERGHYALLAGEDVRPYLQTMTAMTGVGGLLPEQVWDRDPIPEKGLFPGQPSG
SAMPLVWAHGEFIKLCHSVVAKMPVDRPSATWARYQGKRPELSYRLWRLRQRPRRLRVGQ
ELRVLLHRPFRVHWGINGWREIQDTVSEDWDLGQVAFLATEKLPVGTELQWTIQWQDDGS
WLGEDFSLSVVEAEDAEH
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
ttggccaccgaagaggtccccatgtccgcgacagaacccgctccccatgcgcaaagttcc
catccggtctgggccacggcgcaaaaaagcctggtaggtaccgccctgggccccagtcgc
ctgtggtttaccatcgggcgtggcattgtcacggaggtcttttacccgcgcatagatgtt
cctgccattcgcgatctgggttttttgatcagcgatggtgacggtttctggctggaaatc
aagacgaatcccaactggaaccaaagtctggccgacagtcaggtacctttaccggtcatc
gagcaccttcacgagcggtttcgtctgcgtttttcggtggtagcggatcccaagcgggat
gtgctgctgttggattacgatctggaggccgagccctctctccagtgctttgcgctctgc
gccgctcgactgggtggtgatgcgacggccaatcgtgcctggacgggggagtgggagggc
cgggaactcctctgggcagagcaggggccatttggactcgccttgctctgtcgcgatgcc
gagggtaaaccggcctacgggcgccgcagtgtcggtgaggtgggcgccagcgacctttgg
caggactttgcccagcacagtggcgtcatgacctggcactacgatgcggcaggccccggt
gaggtggccatggccggagagcttcctcaccgtggtaccctggccctgggtctagggacg
agcaaggaggcagcggccaccaatgcctgggcaagcctcacccaaggtttcgctgagatt
cgtgagcaatatcagggtgcttggctgcagtggcacagtatgcacaagacgccgcgcggt
tttcggcgccgcttctcgccggccatgcagaatctttaccgccgctccaagaatgtgctc
aaggtgcacgccgaccgcaccttccccggggcgctggtggccagtctttcggtaccctgg
ggtgaggctagcagtagtcgtggtggctatcatctggtctggtctcgggatctcgtggaa
agcgccggggcggcgctggcggcagggatggtggaggaagcacgggaggtgttgtgctac
ctcatcagcacccagcaggccgatggccactggttgcagaatcagtggctgggcggtaag
cccttctggcagggaattcaactggatgaggccggctttcccgtcatcctcgcggcactc
ttgcgggaccagggggcgctgggcgagatcctggtcgacgacatggtgcgcagggcgctg
gccttcatcctgcgggaggggccgacgaccgggcaggatcgctgggaagaggacgccggc
gtaaaccccttcaccttggccgtcgtcattgccgccctgatcgagggggctgagtttctg
gggggcaaggcgggtgcctgcgcgcagatggtggccgattactggaatgcccggctcgag
gactggacctttgtccgcgataccgagttggcccgggtccacggcgtccgcggttattat
ctgcgcatagcacctgaggatatcctggtacaggatggcgccaaggacgaatgggtacaa
atcaagaatcgtgcccacgatcctcacctgccggccagtgagcaggttgccacagacttc
ctccagctggtccgcttcggcctacgcacagcggacgacccgcacatcgtcgactcggtc
aaggtcatggatgcggtgttgcgctgcgacacccccaatggaccggtatggcatcgctac
aacggcgatggctacggcgagcacgccgatggcagccccttcgacggcaccggcatcgga
cgtggctggccgcttttggtgggtgagcgcggccactacgccctgcttgccggagaggat
gtccgcccatacctgcagacgatgacggccatgaccggtgtgggggggctgcttccggaa
caggtctgggaccgggatcccatccccgaaaaggggcttttccccggtcagcccagcggt
tcggccatgccgctggtctgggcccacggcgaattcatcaaactctgccatagcgtcgtt
gccaagatgccggtggatcggccctcggccacctgggctcgctatcagggaaagcggccc
gagttgtcctatcgcctgtggcgcctgcgtcagcgtccgcgtcgcctgcgcgtggggcag
gaattgcgggtgttgttgcaccgacctttccgggtgcactggggaatcaacggttggcgc
gagatacaggacaccgtcagcgaggattgggatctgggccaagtggcgttcctggccaca
gagaagttgcctgtaggtaccgaactgcagtggaccatccagtggcaggacgacggttcc
tggctgggcgaggatttttccttgagcgtcgtggaggctgaagatgctgaacattga

DBGET integrated database retrieval system