KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_c2066Help
Entry
Acaty_c2066       CDS       T03561                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00970  Aminoacyl-tRNA biosynthesis
acz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acaty_c2066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acz03029]
    Acaty_c2066
Enzymes [BR:acz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Acaty_c2066
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Acaty_c2066
Mitochondrial biogenesis [BR:acz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acaty_c2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIA55922
UniProt: A0A060A1A3
LinkDB All DBs
Position
complement(2126847..2128280)
Genome map
AA seq 477 aa AA seqDB search
MSWEVVIGLEVHVQLNTQSKIFCNCPTRYGAEPNRHTCPVCLALPGALPVLNAAAVDKAI
AFGLAVGAEIHQRSVFARKNYFYPDLPKGYQISQYEIPIVGRGQLALTLADGTEKIVGIT
RAHLEEDAGKSLHEAFSAETGIDLNRAGTPLLEIVSEPDMRSPAEAVAYLKKLHALVRYL
DISDGNMQEGSFRCDANVSLRRPGEPFGTRAEIKNLNSFRFLEKAIEYEMERQQDLLESG
AEVVQETRLFDANKGETRSMRSKEEANDYRYFPDPDLLPLVLEPAQIEAVRASLPELPDA
RKRRFMEQYALPAYDAGVLTSSRALADYYEVVAEGVDAKLAANWIMGDLLGALNRSNGEI
ESCPVPAEQMRRLLQRIEDQTISGKIAKDVFEVLFEKGEDVDTIIERKGLRQITDVEAIT
KLIDAVLAKNPGQVADYRSGKEKLFGFFVGQVMKASQGKANPEQLNRLLRERLDNPS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgagttgggaggtcgtcattggtctcgaggtacacgtacagctcaacacgcagagcaag
atattctgcaactgtcccacccgctatggtgcagaacccaatcggcacacttgtcccgtc
tgcctggcactacctggggcactaccggtcctcaatgccgcagccgtggacaaggccatc
gcctttggcctggctgtgggcgcagaaatacatcagcgcagcgtctttgcccgtaagaat
tatttctatcccgatctacccaagggctatcagatcagtcagtatgagattcccattgtc
ggtcgcggccagttggccctgaccttggccgatggcacggaaaagatcgtcggtatcacc
cgcgcacatctggaagaagacgccggcaagtccctgcacgaggcgttctcggcggaaacc
ggtatcgacctcaatcgtgccggcacgccgcttctggaaatcgtgtccgaaccggatatg
cgctcgccggcggaagcggtggcctacctcaagaaactgcacgccctggtccgctatctg
gatatctccgatggcaatatgcaggagggctcctttcgctgcgacgccaacgtctccctg
cgccgcccgggcgagccctttggtacccgcgccgaaatcaagaacctcaattcctttcgc
ttccttgaaaaagccatcgagtacgagatggaacgccagcaggatctgctcgaatccggc
gccgaggtggttcaggaaacgcgcctgttcgacgccaataagggtgagacgcgctccatg
cgcagcaaggaagaggccaacgactaccgctatttccccgatccggatctcctcccattg
gtgctcgagccggcgcaaatcgaggccgtgcgtgcctccttgccggagctaccggacgcg
cggaaacggcgcttcatggagcagtatgcgctgcctgcctacgacgctggcgtgctcacc
agcagtcgcgccctggccgattactacgaggtcgtcgccgagggtgtggatgcaaagctc
gcggccaactggatcatgggtgacctgttgggcgccttgaaccgcagtaatggagaaatc
gaatcctgtccggtgccggcagagcagatgcgcaggttattgcagcgcatcgaggatcag
accatctccgggaagattgccaaggatgttttcgaagtactcttcgagaagggtgaggat
gtcgacaccatcatcgagcgcaaggggctgcgccagattaccgacgtcgaggcaatcacc
aagctcatcgatgcggtcttggccaagaatccggggcaggtggccgattatcggtcgggt
aaggaaaagctgtttggcttctttgtgggacaggtcatgaaagcgtcccagggcaaggca
aatccggagcagctcaatcgcctgttacgagaacggctggacaacccgtcctga

DBGET integrated database retrieval system