KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_c2524Help
Entry
Acaty_c2524       CDS       T03561                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Acaty_c2524
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acz02000]
    Acaty_c2524
Enzymes [BR:acz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Acaty_c2524
Transporters [BR:acz02000]
 Other Transporters
  Pores ion channels [TC:1]
   Acaty_c2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_N_4 GST_C_3 Tom37 DUF1382 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AIA56368
UniProt: A0A059ZY45
LinkDB All DBs
Position
2574989..2575645
Genome map
AA seq 218 aa AA seqDB search
MTLELISFPLCPYVQRSVITLLHKEVLFTLTHIDLAHKPDWFLQISPMGKVPCLRVDDDV
VLFESQVINEYLDETTPPPLHPADPLERARHRSWIAFGGDALADQFQMMVAQGEERFTAA
HRQLFEKLERLEAAASDGPFFAGDSFSLVDAAYAPLFMRMEILHNLRPLPRWESLGKLRR
WAAHLLELPEVAASVQPGFPEQIRNYLSEKGSLLLRSA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacactggaattgatcagcttccctctgtgtccttacgttcagcgctcggtcatcacg
ctcttgcacaaggaagtgctcttcaccctcacccacatcgatctcgcccacaagcccgac
tggttcttgcagatctcccccatgggcaaggtaccctgcctgcgcgtcgacgacgatgtc
gtgctttttgagtcccaggtcatcaacgaatacctggacgagaccacccccccgcccctg
caccccgccgaccctctggagcgcgcccgccatcgctcctggattgcctttggcggcgac
gccctggccgatcagttccagatgatggtggcgcagggtgaggaacgcttcacggcagcc
caccgtcagctcttcgaaaaactcgaacgtctggaggccgccgccagcgacgggcctttc
tttgccggcgattccttcagcctggtggatgccgcctacgcgcccttgttcatgcgcatg
gaaattctgcacaacctgcgcccattgccacgctgggaatccttgggcaaactgcggcgg
tgggcagcacaccttctggagctaccggaagtggccgcgtcggtgcagccgggttttccc
gagcagattcgtaactatctgagcgaaaaaggcagcctgctgctgcgctcagcctga

DBGET integrated database retrieval system