KEGG   Acidithiobacillus caldus ATCC 51756: Acaty_m0190Help
Entry
Acaty_m0190       CDS       T03561                                 

Definition
(GenBank) Glutamate synthase [NADPH] large chain
  KO
K22083  methylamine---glutamate N-methyltransferase subunit C [EC:2.1.1.21]
Organism
acz  Acidithiobacillus caldus ATCC 51756
Pathway
acz00680  Methane metabolism
acz01100  Metabolic pathways
acz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Acaty_m0190
Enzymes [BR:acz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     Acaty_m0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_synthase FMN_dh IMPDH NMO QRPTase_C Glu_syn_central His_biosynth DHO_dh G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: AIA56763
UniProt: A0A059ZZB6
LinkDB All DBs
Position
mpAca1.1:156330..157688
Genome map
AA seq 452 aa AA seqDB search
MKTANHHVPAQEISAGYDPTVLSYIQQAATHGLYEIRGLGAKRRVPHFDDLLLLGASMSR
YPLEGYREKCSTQTVLGTRYASKPIVLDIPITIAGMSFGALSASVKEALGRAASAVGTST
TTGDGGMTEEERIASKILVYQCLPSRYGFRPDDLRRADAIEIVIGQGAKPGGGGMLLGQK
INPRVAAMRTLPAGIDQRSACRHPDWTGPDDLTIKIQELREITDWEKPIYVKIGASRTYH
DVKLAVHAGADVIVLDGMQGGTAATQQVFIEHVGIPTLAALRQAVQALEDLGMKNTVQLV
ISGGIRTGADVAKALAMGADAVSIGQGVLMAMGCNAPTWTDLAGNAIDAQEDYQTLGTMP
GACHHCHTGRCPVGITTQDAILEKRLTPDWAAKRVQNYLQTLTMELTTLARACGKSNVHH
LEREDLVALTVEAAAMARVPLAGTAWVPGLGG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcgaatcaccacgttcctgcacaagaaatatccgccggctacgacccgaca
gttcttagttatatccaacaggcggcgacgcatggtctctacgaaatccgtgggttaggt
gcaaaacgcagagtgccgcacttcgatgacttgttattactgggggcctcaatgtcgcgt
tacccccttgaagggtatcgtgaaaaatgctctacacaaacagtgcttgggacacggtat
gccagcaagcccatcgtcttggatattccgatcactatcgccggtatgagttttggagcc
ctttcggcgtcggtgaaggaagcgttggggcgggctgcctctgctgtcggaacttcaacc
acaacgggcgacggtggaatgacggaagaggagcggatcgcatcaaaaatcctcgtgtat
caatgtttaccttcgcgctatggattccggccagatgacctacgtcgtgccgatgcaatc
gagattgtcattggccaaggtgcgaagccagggggtggtggcatgttgctgggacaaaaa
attaatcctcgcgtggcggccatgcgtaccctaccggccgggattgaccaacgttctgct
tgccgccatcccgattggactggtccagacgaccttacgataaaaatccaggagctccgt
gagattacggattgggagaagccgatatacgttaaaatcggtgcgtctcgcacctatcac
gatgtaaaacttgctgtccacgccggtgccgacgtaatcgtgttggatgggatgcagggg
ggaacagccgcaacccagcaggtcttcatagaacatgtgggcattcccaccctggctgcg
ctgcgtcaggcggtgcaggctctggaagatttgggaatgaaaaacacggtgcagttggta
atttctggaggtatccgcaccggcgcggacgttgccaaggcgttggcaatgggggcagac
gcggtatccataggacaaggagtgctcatggcgatgggctgtaatgcgccgacatggacg
gacctcgctggaaacgcaatagacgcacaggaggactaccaaaccctggggacaatgccg
ggagcatgtcaccactgtcacacggggcgttgtcccgtcggcataacgactcaggatgcc
attctggagaaacgattaactccagattgggcagcgaagcgggttcagaattatctgcaa
acgctcactatggagttaactactctggcacgtgcatgtggaaagagtaacgtccatcat
ctggagcgagaagacttggtagcgctcaccgtggaggcggccgcaatggccagagtaccg
cttgcaggaacagcatgggtgcctggactgggaggttag

DBGET integrated database retrieval system