KEGG   Abiotrophia defectiva: FOC79_01170
Entry
FOC79_01170       CDS       T06623                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
adc  Abiotrophia defectiva
Pathway
adc00550  Peptidoglycan biosynthesis
adc01100  Metabolic pathways
adc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FOC79_01170 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FOC79_01170 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adc01011]
    FOC79_01170 (murG)
Enzymes [BR:adc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     FOC79_01170 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:adc01011]
 Precursor biosynthesis
  Glycosyltransferase
   FOC79_01170 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Epimerase_2 Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4 UDPGT
Other DBs
NCBI-ProteinID: QKH46297
LinkDB
Position
complement(261041..262153)
AA seq 370 aa
MTEIKRIVLSGGGTGGHIYPALALYQVIKAKYPDVECLYVGSKKGLEADIVAKEGLAFQS
VEIQGLKRSLSLENLKTAWLMLTSVHKAKKILRDFKPDVVIGTGGYVCAPVLYAASRLGI
PSLIHEQNSVAGVTNKFLSRFVNRIATCFEEVKSDFKGQEAKIILTGNPRGQEVVATPKM
DTILSEQFQLDDQVPTVLVFGGSRGAPAINQAAVEAIPSFAGKDYQVIVATGRVHYDELR
QSLKEELPSNVRLVPYIDNMPSLLRQIKLVVGRSGATSLTELTALGLPSILVPSPYVTNN
HQEHNAMALVDHGAARMIKQADLTGASLVETIQELMADPENLEKMARSAYELGIRDASDR
LVKVLEEIIK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgactgagattaaacgtatcgtactttcaggtggcggaacaggtggtcatatctatcca
gctctcgccctctatcaagtcattaaagccaaatatccggatgtagagtgcctctatgtt
ggtagtaagaagggcttggaggcagatatcgttgctaaagaagggctcgccttccaatca
gttgagattcagggtttaaaacgttctttatcccttgaaaaccttaagacagcttggctt
atgttaaccagtgtccacaaggcaaaaaagatcttacgggactttaagccagatgtggtg
attgggacaggaggttatgtttgtgcaccagtcctctatgcagctagccgtctaggtatt
ccaagtttaattcatgaacaaaatagtgtagcaggtgttaccaataaattccttagccgt
tttgtcaatcgcattgcaacttgctttgaagaagtgaaaagtgactttaaggggcaagaa
gccaagattattttaactggcaatccgcgaggccaagaagtagtagctacacctaaaatg
gacaccatcctttcagagcaattccagttggatgatcaagtgccaactgtcttagtattt
ggggggagccgtggtgcgccagctatcaaccaggcggccgttgaagccattccgtccttt
gctggaaaagactaccaagtgattgtggccacagggcgagtgcattatgatgaattgcgc
caaagccttaaggaagagctaccgtctaacgtccgtctagtgccttatatcgacaatatg
ccaagcctcttgcgtcagattaagttggtagttggtagaagtggggcaactagcttaacg
gaattaacggcattaggcttgccaagtattctggtgccaagtccttatgttactaacaac
caccaggaacacaatgccatggctcttgtagaccatggagccgctcgtatgattaagcaa
gcggatttgactggggctagcctagtggagaccatccaggaactgatggctgacccagaa
aacctagagaaaatggctcgctcagcctatgaattaggaattcgtgacgcctcagatcgc
ttagtcaaagttctggaagaaatcattaagtaa

DBGET integrated database retrieval system