KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0115Help
Entry
Adeh_0115         CDS       T00326                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Brite
KEGG Orthology (KO) [BR:ade00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ade01001]
    Adeh_0115
Enzymes [BR:ade01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Adeh_0115
Protein kinases [BR:ade01001]
 Serine/threonine kinases: Other
  Bacterial family
   Adeh_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ABC79892
UniProt: Q2IM57
LinkDB All DBs
Position
139800..141566
Genome map
AA seq 588 aa AA seqDB search
MPGPLAIPDLRAPCPGCGHLAEPAGGPLNFCPRCGLDLRETARRAPPPDPLVGRVIADRY
RLVSLLGEGGMGAVYRAEHVQMGKALAVKVLRGDFARDPSAAERFRAEARIVSRLSHPHT
IAVFDFGELPERGFYLAMEYVPGQDLARALREGGAFSEARAVGVAQQVLGSLAEAHEAGV
VHRDMKPANVMLMQARPGEDFAKVLDFGIAKLRDEAGGATTGAGAVVGTPSCLAPEQARG
GPVDARADLYAMGCLLYELVSGRPPFTAASPVAVITAHLHDPPPPLRQVAPGVSPRLAEV
VHRALRKDPAERFPSADAMRAALAGPGHPARPSRRPALPRAAGELELASREDFRDGLEQG
ALERQVGVLRPQRLVTPAGAALVAAVALAAGAAWRWDDLYAALADRAPGIAARVPAALRP
AAAAWVEREPNDGAAEATPLPLLPRADGVPAAEVRGAVGAPRRPDEGDLDVYRLAVPDGA
GRRVLRARWHAAGAAPDQGIPGLAVTLSLNRAPAGAERAPLVAAAGEGGPGAAEALSAEV
EPGTYWLSVRERHAAGAAPAGRPDAPYALEVELAPPAPGEAATRAPQK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccccctggcgatccccgacctccgcgccccgtgccccggctgcggacacctc
gcggagccggccggcgggccgctgaacttctgcccgcgctgcggcctcgacctgcgcgag
acggcgcgccgcgcgccgccgccggacccgctggtgggccgggtgatcgcggaccgctac
cggctcgtctccctgctcggcgagggcggcatgggcgcggtctaccgggccgagcacgtg
cagatgggcaaggcgctcgcggtgaaggtgctgcggggcgacttcgcccgcgacccgtcc
gccgcggagcgcttccgcgccgaggcgcgcatcgtgtcgcgcctctcgcacccgcacacc
atcgcggtcttcgacttcggcgagctgcccgagcgcggcttctacctcgccatggagtac
gtgcccgggcaggacctggcgcgcgcgctgcgcgagggcggcgcgttctccgaggcgcgg
gcggtcggcgtcgctcagcaggtgctcgggtcgctggccgaggcgcacgaggcgggcgtg
gtccaccgcgacatgaagcccgcgaacgtgatgctgatgcaggcgcggccgggcgaggac
ttcgcgaaggtgctcgacttcgggatcgcgaagctgcgcgacgaggcgggcggcgccacc
accggcgcgggcgcggtggtgggcacgccgagctgcctcgcgccggagcaggcccgcggc
ggcccggtggacgcgcgcgccgacctctacgccatgggctgcctgctgtacgagctcgtg
tccgggcggccgccgttcaccgcggcgagcccggtggcggtgatcaccgcgcacctccac
gatccgccgccgccgctccggcaggtcgccccgggcgtctcgccgcgcctcgccgaggtg
gtccaccgcgcgctccgcaaggatcccgccgagcggttcccgagcgcggacgcgatgcgc
gccgcgctcgccgggcccgggcacccggcccgcccgtcccgccgccccgcgctcccccgg
gccgcgggcgagctcgagctggcgagccgggaggacttccgcgacggcctggagcagggc
gcgctggagcggcaggtgggcgtgctgcgcccgcagcggctcgtcacgcccgccggggcc
gcgctggtggcggccgtcgcgctcgccgccggggccgcctggcgctgggacgacctgtac
gcggcgctcgccgaccgcgcgcccgggatcgcggcgcgggtgccggcggcgctccgcccg
gccgcggccgcctgggtggagcgcgagccgaacgacggcgcggcggaggcgacgccgctc
ccgctgctcccgcgcgcggacggcgtgcccgccgcggaggtgcgcggcgccgtcggcgcg
ccgcgccggccggacgagggcgacctcgacgtgtaccgcctggccgtgccggacggcgcg
ggccggcgggtgctgcgggcgcgctggcacgcggcgggggccgcgccggaccagggcatc
ccggggctcgcggtgacgctctcgctcaaccgggcgccggccggggccgagcgggcgccg
ctcgtggccgccgccggcgagggcgggccgggcgcggccgaggcgctctcggccgaggtc
gagccgggcacctactggctgtcggtgcgcgagcggcacgcggcgggcgccgcgccggcc
gggcggccggacgcgccctacgcgctcgaggtggagctcgcgccgccggcgccgggcgag
gccgcgacgcgcgcaccgcaaaaatga

DBGET integrated database retrieval system