KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0784Help
Entry
Adeh_0784         CDS       T00326                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ade00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Adeh_0784
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ade03400]
    Adeh_0784
Enzymes [BR:ade01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Adeh_0784
DNA repair and recombination proteins [BR:ade03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Adeh_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_A_M RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ABC80559
UniProt: Q2IP30
LinkDB All DBs
Position
complement(904718..906694)
Genome map
AA seq 658 aa AA seqDB search
MARAPVPTYRAQLATLVAAPPAGAGWVHETKYDGYRIGCALEGGRATLWSRRGNDWTAQF
PEVARAAEALPVRSALLDGEVAAVLPGGRTSFQALQQAFSGGRRSLAYFVFDLLWLDGED
LSRRPLLERKDALRRLLGARREVLRYAPHVDAPGAEVLREACRLGLEGIVSKRADAPYRP
GRNTTWTKAKCLARQELVIGGFTDPEGSRQGIGALLVGFHEGGALRFAGKVGTGFTQASA
RALRARLDRLERTDPPFTPRPPGALGRIAHWVRPELVAEVAFAEWTDDGKVRHPSFQGLR
EDKRAADVVRERPGAGAPPPAAASPPPQAPGAGGPARRRRPAGGPGEVVIGGVRLSHPER
LVFPGEGRTGLTKADVARYYDAVAGAMLPHLRGRPLTLFHCPQGLSGECRFMKHSKTWAP
PAVRRVRIQEKTKLGEYLIADDRAALLSLVQLDVLELHTWNATADALETPDRIVLDLDPG
PAVPWPEVVRAARLLRSALEALGLAAFVKTTGGAGLHVVTPLVPRRRWEDCLAFARGLAA
TVARHEPRAFTVAFARAGRERKILLDYLRNNRTNTSVAAFSLRARPGAPASVPVAWDELG
PRLRPERLGARTVPRRLARLGADPWAGYARAARPLADAHLAAVGAAPAAAPARGGGRR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgcgcccgtcccgacctaccgcgcccagctcgcgaccctcgtcgcggccccg
ccggccggcgcgggctgggtgcacgagacgaagtacgacgggtatcgcatcggctgcgcg
ctcgagggcgggcgcgccacgctgtggagcaggcgcggcaacgactggaccgcgcagttc
ccggaggtggcgcgcgccgccgaggcgctcccagtgcggagcgcgctgctcgacggcgag
gtcgccgcggtgctgcccggcggccggaccagcttccaggcgctccagcaggcgttctcc
ggcgggcgccgctcgctcgcctacttcgtgttcgacctgctctggctcgacggcgaggac
ctctcccggcgcccgctgctcgagcgcaaggacgcgctgcgccggctgctcggcgcgcgc
cgcgaggtgctccgctacgcgccgcacgtggacgcgcccggcgccgaggtgctccgcgag
gcgtgccgcctcggcctggaggggatcgtctcgaagcgcgccgacgcgccgtaccggccc
gggcggaacaccacctggacgaaggcgaagtgcctcgcccgccaggagctggtgatcggc
ggcttcaccgatcccgagggcagccgccagggcatcggggcgctgctggtgggcttccac
gagggcggcgcgctgcgcttcgccgggaaggtcggcaccggcttcacgcaggcgtcggcg
cgggcgctgcgcgcgcgcctggatcgcctggagcgcaccgacccgcccttcacgccacgc
ccgcccggcgcgctcggccggatcgcgcactgggtccggccggagctggtcgccgaggtg
gcgttcgccgagtggaccgacgacgggaaggtgcgccacccgtcgttccaggggctgcgc
gaggacaagcgcgcggcggacgtcgtccgcgagcgccccggcgccggcgcgccgccgccc
gcggccgcctccccgccgccgcaggcgcccggcgccggcggccccgcgcggcggcgccgc
ccggcgggcggaccgggcgaggtggtgatcggcggcgtccgcctctcgcacccggagcgc
ctggtgttcccgggcgaggggcggaccgggctcaccaaggcggacgtggcccggtactac
gacgcggtggccggcgcgatgctgccgcacctgcgcggccggccgctcaccctgttccac
tgcccgcagggcctctccggcgagtgccgcttcatgaagcactcgaagacctgggcgccg
cccgcggtgcggcgcgttcgcatccaggagaagacgaagctgggcgagtacctgatcgcc
gacgaccgcgcggcgctgctctcgctcgtgcagctggacgtcctcgagctgcacacctgg
aacgcgaccgcggacgcgctggagacgccggaccggatcgtgctcgacctcgacccgggg
ccggcggtcccctggccggaggtggtgcgcgcggcgcggctgctgcgctcggcgctggag
gcgctggggctcgccgcgttcgtgaagaccaccggcggcgccgggctgcacgtggtgacc
ccgctcgtgccccgccggcgctgggaggactgcctcgcgttcgcgcggggcctcgccgcc
acggtggcgcgccacgagccgcgcgcgttcacggtggcgttcgcgcgcgcggggcgcgag
cggaagatcctgctcgactacctgcggaacaaccggaccaacacctcggtggcggcgttc
tcgctccgggcgcggccgggcgcgccggcgtcggtgccggtggcctgggacgagctgggg
ccgcggctgcggccggagcggctgggggcgcggacggtcccgcggcggctggcgcggctc
ggcgccgacccgtgggccgggtacgcgcgcgccgcccggccgctcgccgacgcccacctg
gccgcggtgggcgccgcgccggcggccgcgccggcgcgcggcggggggcggcggtga

DBGET integrated database retrieval system