KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_1952Help
Entry
Adeh_1952         CDS       T00326                                 

Definition
(GenBank) Manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Brite
Enzymes [BR:ade01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Adeh_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N CsiD
Motif
Other DBs
NCBI-ProteinID: ABC81723
UniProt: Q2IJ89
LinkDB All DBs
Position
complement(2192025..2192630)
Genome map
AA seq 201 aa AA seqDB search
MADVKRYTPHDFSKVRGLTGISDKQVEEHLKLYEGYVKRTNALTEKLQGLCNEGKASGAD
PVFAELTRRLGFEYSGMVNHEYYFANLAPGAQAEPPAGGKLRKAIEASFGKYETWLADFR
AIATMPGIGWAMTFQDPTTGWLSNHWLTLHENNVPVGFRPVLALDGWEHAFMRDYLATER
AKYVDAFFKNVNWEAVEKRLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtgaagcgctacaccccgcacgacttctccaaggtgcgcggcctcaccggc
atctccgacaagcaggtcgaggagcacctcaagctgtacgagggctacgtgaagcgcacc
aacgcgctcaccgagaagctccaggggctgtgcaacgagggcaaggcctccggcgccgac
ccggtgttcgcggagctcacccgccgcctcggcttcgagtactccggcatggtgaaccac
gagtactacttcgcgaacctcgccccgggcgcgcaggccgagccgcccgccggcggcaag
ctccgcaaggcgatcgaggcgtcgttcggcaagtacgagacctggctcgccgacttccgc
gccatcgccaccatgccgggcatcggctgggccatgacgttccaggacccgaccaccggc
tggctgtcgaaccactggctcacgctgcacgagaacaacgtgccggtgggcttccggccg
gtgctggcgctggacggctgggagcacgcgttcatgcgcgactacctcgccaccgagcgc
gcgaagtacgtggacgcgttcttcaagaacgtgaactgggaggcggtcgagaagcggctc
gcgtag

DBGET integrated database retrieval system