KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_3339Help
Entry
Adeh_3339         CDS       T00326                                 

Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00550  Peptidoglycan biosynthesis
ade01100  Metabolic pathways
ade01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Adeh_3339
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Adeh_3339
Enzymes [BR:ade01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Adeh_3339
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Adeh_3339
Glycosyltransferases [BR:ade01003]
 Polysaccharide
  Bacterial polysaccharide
   Adeh_3339
Peptidoglycan biosynthesis and degradation proteins [BR:ade01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Adeh_3339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB S1
Motif
Other DBs
NCBI-ProteinID: ABC83106
UniProt: Q2IEV1
LinkDB All DBs
Position
3838937..3841624
Genome map
AA seq 895 aa AA seqDB search
MRRRISRKSKRLLRAAALTVLAGGLLGGGLLVAWTRELPAFDGLKDYAPLVSTRVFGADG
EEVFQFARERRTVVPIDGIPDVLKKAVLAAEDARFYEHEGVNYLAIARCAAKGLLGGGVK
CGGSTITQQVVKTFLLPTEWRVKRKVKELVLAPRLEQNLTKDEILYLYLNQIYFGHRRYG
VEEASRFYFGKGVKDLTLGEAAALAGVIQSPMRWSPVNHPARAKERQKYVLRRMMEEGFI
TRAQAEAEAARAIRTRPPPEDPPGAWYADAVRKYLDERYGAEVVETQGLQVDVAMDARLQ
AAAETALEGALRAVDKRQGWRGPLLHLDRPRVEAALPLWRKRLEAIEPGPGDVYVWDLGR
VNPDQIEPGEDAEQERDVARMARARRLEDGGVYAGLVREVDDRAAVVDLGNARGEVTLAQ
AAWARKWNPTSATAAPKKLSTVLQPGDVVNVRVVPGKVPAARTAAAGKPLPLALEQTPLV
QGALVAIDPATRGVRALVGGLDFQASQFNRATQARRQPGSAMKPFVWGAAIESRRFTPAT
VVYDTPDLYRDPWTGKEWKPRNFEKDQFDGPMLLASALAHSKNTVSVKLVDALGVDAVIG
FSKRMGIASELPRNLTLALGTGEVLPIELVNAYASLAANGFQTPPLVVLRVRDRTGKVLE
EQRPVAPPAPSPDGAVVVTASAVDPAGAPAAPAAAPTPAAPAAAPAPADAAAGALAAAAP
AIAGAGATAAPAPFVVPASGTRPDVSYVVTSMLRGVIEGGTGAAARVLARPAAGKTGTAQ
DHRDAWFVGYTPELVAGVWVGFDDHSPLGPRETGAVAALPAWIAFMQGALGGRPATDFDP
VPGVELARVDPQSGMLAPPDQAGAPALPFLSGTAPAQEASSHPGSAPQNFFMDDH
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtcgcatctcccgcaagtcgaagcggctcctccgcgccgccgccctgaccgtg
ctcgccggcgggctgctcggcggcggcctgctcgtcgcctggacccgggagctgcccgcg
ttcgacggcctgaaggactacgcgccgctcgtctccacccgcgtcttcggcgccgacggc
gaggaggtgttccagttcgcccgcgagcgccgcaccgtggtgccgatcgacggcatcccg
gacgtgctgaagaaggcggtgctcgcggcggaggacgcgcgcttctacgagcacgagggc
gtgaactacctcgccatcgcgcgctgcgcggcgaaggggctgctgggcggcggcgtgaag
tgcggcggctcgaccatcacgcagcaggtggtgaagacgttcctgctgcccaccgagtgg
cgcgtgaagcgcaaggtgaaggagctcgtgctcgcgccgcggctcgagcagaacctgacc
aaggacgagatcctctacctgtacctgaaccagatctacttcgggcaccggcgctacggc
gtggaggaggcgagccgcttctacttcggcaagggcgtgaaggacctcacgctcggcgag
gcggcggcgctggccggcgtgatccagtcgcccatgcgctggtcgccggtgaaccacccc
gcccgcgccaaggagcggcagaagtacgtgctgcgccggatgatggaggagggcttcatc
acgcgggcgcaggccgaggccgaggcggcgcgcgccatccgcacgcgcccgccgccggag
gatccgcccggcgcctggtacgcggacgcggtccggaagtacctggacgagcgctacggc
gccgaggtggtcgagacgcaggggctccaggtggacgtggccatggacgcgcggctgcag
gcggccgccgagaccgcgctcgagggcgcgctgcgcgccgtggacaagcgccagggctgg
cggggcccgctcctccacctcgaccggccgcgggtggaggcggcgctcccgctctggcgc
aagcggctcgaggcgatcgagccgggcccgggcgacgtgtacgtgtgggacctcgggcgc
gtgaaccccgaccagatcgagccgggcgaggacgcggagcaggagcgcgacgtggcgcgc
atggcgcgcgcgcgccggctggaggacggcggcgtctacgccggcctggtgcgggaggtg
gacgaccgggccgcggtggtggacctgggcaacgcgcgcggcgaggtgacgctggcgcag
gccgcctgggcccgcaagtggaacccgacctccgccaccgccgcgccgaagaagctgtcc
acggtgctgcagccgggcgacgtggtgaacgtgcgcgtggtgccggggaaggtgccggcc
gcgcgcaccgcggccgccggcaagccgctgccgctcgcgctggagcagaccccgctcgtg
cagggcgcgctggtggccatcgacccggccacccgcggcgtgcgcgcgctggtgggcggg
ctcgacttccaggcgtcccagttcaaccgcgccacgcaggcgcgccggcagcctggcagc
gccatgaagccgttcgtgtggggcgccgccatcgagtcgcgccgcttcaccccggccacg
gtggtctacgacacccccgacctctaccgcgacccgtggaccggcaaggagtggaagccg
cgcaacttcgagaaggaccagttcgacggccccatgctgctggcctcggcgctggcccac
tccaagaacaccgtctcggtgaagctggtggacgcgctcggggtggacgcggtcatcggc
ttctcgaagcggatggggatcgcgtccgagctgccgcgcaacctcacgctcgcgctcggg
accggcgaggtgctgcccatcgagctggtgaacgcgtacgcgagcctcgcggcgaacggc
ttccagacgccgccgctggtggtgctgcgcgtgcgcgaccgcaccggcaaggtgctggag
gagcagcggccggtcgcgccgccggcgccgtccccggacggcgcggtggtggtgaccgcg
tccgccgtcgatccggccggcgcccccgcggccccggccgccgcgcccacccccgccgcc
cctgcggccgccccggcccccgcggacgcggccgccggcgcgctcgccgccgcggccccg
gcgatcgccggcgcgggcgccaccgccgcccccgcgccgttcgtggtcccggcctcgggc
acccggcccgacgtctcgtacgtcgtcacctcgatgctgcggggcgtgatcgagggcggg
acgggcgccgccgcgcgcgtgctggcgcggcccgccgccggcaagaccggcaccgcccag
gaccaccgcgacgcctggttcgtcggctacacgccggagctggtcgcgggcgtgtgggtc
ggcttcgacgaccactcgccgctcgggccgcgcgagaccggcgcggtggcggcgctcccg
gcgtggatcgcgttcatgcagggcgcgctgggcggacggcccgcgaccgacttcgatccg
gtgcccggcgtcgagctggcgcgggtcgatccgcagagcggcatgctcgccccgcccgac
caggccggcgcccccgcgctgccgttcctctccggcaccgcgccggcgcaggaggcctcg
tcgcaccccggctccgcgccgcagaacttcttcatggacgaccattga

DBGET integrated database retrieval system