KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_4059Help
Entry
Adeh_4059         CDS       T00326                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
ade00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ade01100  Metabolic pathways
ade01110  Biosynthesis of secondary metabolites
ade01130  Biosynthesis of antibiotics
ade01230  Biosynthesis of amino acids
Module
ade_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ade00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeh_4059
Enzymes [BR:ade01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Adeh_4059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB
Motif
Other DBs
NCBI-ProteinID: ABC83823
UniProt: Q2IGW1
LinkDB All DBs
Position
complement(4669422..4670435)
Genome map
AA seq 337 aa AA seqDB search
MLVVMKPHAGQPEIDAVIEKIRSLGLTAHPIPGAQRVAIGITGNKGGLEPELFTTLPGVA
DALRVSQPFKLVSREVKEEDTVIDVGGVPLGGRELAVMAGPCSVESRGQLLEAAHAVKAA
GARFLRGGAFKPRTSPYEFQGLGEEGLKLLAVAREETGLKVVTEVMDVEHLAMVADYADV
LQIGARNMQNYSLLRQLGRVRRPILLKRGPSATIKEWLMAAEYVVSEGNYQVALCERGIR
TFETMTRNTLDLNAVPILKALTHLPVIVDPSHGIGLRAHVPAMARAGIAAGADGIIVEVH
PRPEKALSDGQQSLTPAEFEELMRQVRVIAGAVGRGV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcgtcatgaagccccacgccggccagccggagatcgacgcggtgatcgagaag
atccgcagcctcggcctcaccgcgcacccgatccccggtgcgcagcgcgtggccatcggc
atcacgggcaacaagggcggcctcgagcccgagctgttcaccacgctgccgggcgtggcc
gacgcgctccgggtgtcccagccgttcaagctcgtgtcccgcgaggtgaaggaggaggac
acggtcatcgacgtgggcggggtgccgctcggcggcagggagctggcggtgatggccggg
ccgtgctcggtcgagtcgcgcggccagctgctcgaggcggcgcacgcggtgaaggccgcc
ggcgcccgcttcctgcgcggcggcgcgttcaagccgcgcaccagcccctacgagttccag
ggcctcggcgaggagggcctgaagctgctcgcggtcgcccgcgaggagaccggcctcaag
gtcgtgaccgaggtgatggacgtcgagcacctcgcgatggtggcggactacgccgacgtg
ctgcagatcggcgcccgcaacatgcagaactactcgctgctccggcagctcgggcgcgtg
cgccggcccatcctgctgaagcgcggcccctccgccaccatcaaggagtggctgatggcg
gcggagtacgtggtctcggagggcaactaccaggtggcgctctgcgagcgcggcatccgc
accttcgagaccatgacccgcaacacgctcgacctgaacgcggtgcccatcctgaaggcg
ctcacgcacctgccggtgatcgtggacccgtcgcacggcatcggcctgcgcgcccacgtc
cccgccatggcgcgcgccggcatcgccgccggcgcggacgggatcatcgtcgaggtccac
ccgcggccggagaaggcgctctccgacggccagcagtcgctcacgccggccgagttcgag
gagctcatgcgccaggtgcgggtgatcgccggcgccgtgggccgcggggtgtag

DBGET integrated database retrieval system