KEGG   Acropora digitifera (stony coral): 107330755
Entry
107330755         CDS       T04352                                 

Definition
(RefSeq) ras association domain-containing protein 5-like
  KO
K09850  Ras association domain-containing protein 1
Organism
adf  Acropora digitifera (stony coral)
SSDB
Motif
Pfam: RA Ras_bdg_2 FERM_f0 TUG-UBL1
Other DBs
NCBI-GeneID: 107330755
NCBI-ProteinID: XP_015750804
LinkDB
Position
Un
AA seq 195 aa
MTKESSFQDDKRKEPFTLYTEPPTGSLLRKKIDEFNSSTTGLIMTMRGGNTFQGFIRVQM
NLLRPINIIAGESPLSIFDPAQKEEDHRNPQRTSFFIPSGTSKALHVTSETTVHEVIVAL
LKKFKVADNPRKFALFECFQEENKHIILRPMSDMEKPLVLRLLWGGADLRHNFSLQENET
GDIVVSCTGFIPDCP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgactaaagaatcttcctttcaggatgacaagaggaaagagcccttcacgctttatact
gagcccccaacaggaagccttctgcgaaaaaagattgatgaattcaattcctcaacaaca
ggacttataatgacaatgagagggggaaacacattccaaggttttatacgcgttcagatg
aatctacttcgccccattaacatcattgctggcgagagtccattatctatatttgatcca
gcacaaaaggaagaagatcaccggaatccacagagaacttcatttttcattcctagtgga
acatcaaaagctcttcatgttacaagtgaaaccacagtccatgaggtgattgtggctctc
ctgaaaaaattcaaggttgctgataatcctagaaaatttgctttgtttgagtgttttcaa
gaagaaaataaacacattatccttcgtcccatgtcagacatggagaagcctcttgttttg
aggttgctgtggggtggagctgacctcagacataacttttcactgcaggagaatgaaacg
ggggatattgttgtaagttgcacaggttttatccctgattgtccataa

DBGET integrated database retrieval system