KEGG   Acropora digitifera (stony coral): 107332651Help
Entry
107332651         CDS       T04352                                 

Definition
(RefSeq) chromo domain-containing protein cec-1-like
Organism
adf  Acropora digitifera (stony coral)
SSDB OrthologParalogGFIT
Motif
Pfam: CBX7_C Chromo
Motif
Other DBs
NCBI-GeneID: 107332651
NCBI-ProteinID: XP_015752870
LinkDB All DBs
Position
Un
AA seq 474 aa AA seqDB search
MDLIGTCYTDVTHHNTHTTKQRRRTLKFSQQKFSSLIFKSQLNSFEDKANGQLAKKIHGG
SDKASQQSSSFTDPLLHDGKIEYLVKWKGWSPKHNTWEPADNILDGRLLLAYENSRKRRG
KRSRWQRGITTSAKRPRTDTSPHFESSETNVFTWDGVDDESSVRANESESSDSSFGVDDV
STSELDINGNDLVPNMKARPHVSPEPRFSFGGSVDANLEGRRPLTNHKMTVLSGVEPRSS
CEKSAEISSLDRPNVKISSKGSEDITYWASSPQETKLKIISEGLDGHEIVVHEKDTNDPG
TEPHGNHKVVKAVENVYHETKKITSQMYHEGLSGALHLGTNGDVARKTVNGDRHAEAFPS
ENGKDMGENAVSSSKSCCRSDGSEKRTFATMTGCSEAGRSCGLQNKTGRNGETLVSEVTM
SRCSSENRHSHQESIKAGWRKPLIDQIFITDVTTNFVTVTVKECLTDKGFFRQR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggatttgatcggtacgtgctacactgacgtcactcaccataacactcacacaaccaaa
cagcgtcggcgaacattgaaattctctcaacaaaagttttcttctctcattttcaaatcc
caattaaacagctttgaagacaaggcaaatggtcaattagccaaaaaaatacacggagga
agtgataaagcgagtcagcagtcttccagttttacagaccccctgctacatgacggaaag
atcgagtatttggtgaaatggaaaggctggtcaccaaaacacaacacctgggaaccagca
gataatatacttgacggtcgactgcttctagcctacgaaaatagccgtaaacgaagaggt
aaaagatcaaggtggcagagaggaattacaacttcggctaaaaggcctaggactgacacg
agtccccattttgaatcaagcgagacgaatgtattcacttgggatggcgtggacgatgag
agttcagttcgtgctaatgaaagtgaaagcagtgattctagttttggagtagacgatgtt
tcgaccagtgaactcgacatcaacggcaatgacttggttccaaatatgaaagctcggcca
cacgtttctcccgagccgaggttcagcttcggtggttcggttgatgctaacttagagggg
agaagacctttgacaaaccacaaaatgacagtgctctccggcgttgagcctagaagctcg
tgtgaaaaatcggccgagatttcgagtttagatcggccgaacgtgaagatatctagcaaa
gggagcgaagacatcacctactgggcctcgagtccacaggagacgaaattaaagatcatt
tcggaaggattagacggtcatgaaattgtcgtgcacgagaaagacacaaacgaccccgga
actgaaccacatggcaaccataaagtcgtgaaggcagtcgaaaacgtttatcacgaaacc
aagaaaattacttctcaaatgtaccatgagggccttagcggtgctcttcatctgggcaca
aacggagacgttgcacggaaaacggtgaacggagatcgtcacgctgaagcctttccaagc
gaaaatggtaaggacatgggcgagaatgcggtctcgtcaagcaaaagttgctgtcgcagc
gatggcagcgagaaacggacttttgcaacgatgacaggttgtagtgaagctggaagaagc
tgtgggttacaaaataaaacggggagaaatggagagacattagtttccgaggtgacaatg
tcacggtgttcgtctgagaatcgtcattctcaccaggaaagcatcaaggcgggctggcga
aaaccactaattgatcaaatcttcatcacggatgtaacaacaaattttgttactgttacc
gtcaaagaatgtttgactgataaaggcttttttcgccaacggtga

DBGET integrated database retrieval system