KEGG   Acropora digitifera (stony coral): 107335801
Entry
107335801         CDS       T04352                                 

Definition
(RefSeq) caspase-10-like
  KO
K04400  caspase 10 [EC:3.4.22.63]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107335801
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.63  caspase-10
     107335801
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107335801
SSDB
Motif
Pfam: DED Peptidase_C14 PYRIN
Other DBs
NCBI-GeneID: 107335801
NCBI-ProteinID: XP_015756325
LinkDB
Position
Un
AA seq 509 aa
MTMAEGELNSILFVLSNGMRAHDLQNLKHLCHGKIPLGDLEKAQSARDVFRIMRQKLLIR
PGKLDLLESMLKQIGRADLAKKLQSGGGADTTMESEGALRRNSLEGNNREFLMTLSDELT
KENVESLKFIADLPYGVEERIQNGRDFFKYLQQAGNVGPNLLSYLEDLFGKIHRMDLAMK
VREYQDQQMGVNTINTNKIGVAPVGNMIPRPCPAVSPVTGKQPTMHQMSDVKSPTMVLLS
PADFSKPPQPSEPSEPRYPVQAEPNVTELLDPLQRIGMDQEDAMPSYPMNQRPRGIALII
SNEHFGGNPLLRDRQGNKKDIEHLQELWSFLNFQVEIRRDLNSQDIYNVMREISSLDHSQ
FDCFVCCLLSHGAHGGIYGTDSELVEIKDITALFKGVACPSLYNKPKLFFIQACRGQGFD
RGARMQADATEVSPEDALRHNAEPNESHFLLGYATPPGIFLLYSKYSREACFSESVCTCN
PRRGVDSNSNSKLTKYPYKMSNCNQIIIH
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgacgatggcagagggggagttaaattccatcctttttgtcctttctaatggaatgaga
gctcatgatcttcaaaatctgaagcacttgtgtcatggtaagattccgcttggagacctc
gagaaagcacaaagtgcacgagatgttttccgaatcatgcggcaaaaacttttgatccga
cctggaaaattggacttattagaaagtatgttaaagcagattgggagagcagatttagcg
aagaaacttcagtctggtggaggagcagatacaaccatggaatctgagggtgcacttcga
agaaattctttggaagggaacaaccgagaatttctcatgacgctttctgatgagttaacc
aaagagaacgttgagtcgttgaagtttattgcggatctaccttatggagttgaagaaagg
atccaaaatggaagagacttctttaaatacctgcagcaggctgggaatgttggaccaaac
ctgttaagctaccttgaagatctctttggaaagatacatcgaatggatttagctatgaaa
gtcagggaatatcaagaccagcaaatgggtgtaaatacaatcaacaccaataaaataggt
gttgcaccagttggcaacatgataccaagaccttgtccagctgtctcaccagtaacaggg
aaacaacctacaatgcaccaaatgtctgatgttaagtccccaacaatggtgctgctgtcc
cctgctgacttctccaaacctcctcaaccttcagagccttctgagccacgttatcctgtc
caagcagagcccaacgtaacggaattgctagatcctttgcagcgtattggaatggaccag
gaagatgcaatgccttcgtatcccatgaatcagcgtcctcgcggtattgctctgatcatc
agcaatgagcattttggagggaacccgttattgagagatcggcaagggaataaaaaggac
attgagcacctccaggaactgtggtcgtttttaaatttccaggtagagataaggcgtgac
ctgaactcgcaagacatctacaacgtcatgcgagagatatcatccctagatcacagtcag
tttgactgttttgtttgttgcctgctaagccatggtgcacatggaggaatctatggcact
gactctgaactagtggagataaaagatatcacggccctcttcaaaggagttgcatgtccc
tctctctacaataaacccaaattgtttttcatccaagcttgcagaggtcaaggttttgat
aggggggcacgtatgcaggcagatgccacagaagttagccctgaggatgcattacgacac
aatgctgaacccaatgagagtcattttctccttggctacgccacccctccaggtattttt
ttgttgtattcgaaatattcaagggaggcgtgttttagtgaaagtgtttgtacatgtaac
cctcgcagaggtgtagacagtaactcaaattcaaaactaacaaaatatccctacaagatg
agtaactgtaatcagattattattcattga

DBGET integrated database retrieval system