KEGG   Acropora digitifera (stony coral): 107335805
Entry
107335805         CDS       T04352                                 

Definition
(RefSeq) caspase-3-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107335805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107335805
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     107335805
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107335805
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 107335805
NCBI-ProteinID: XP_015756331
LinkDB
Position
Un
AA seq 435 aa
MESEGALRRNPSEANYRGFLMTLSDELTKENVESLKYIADLPYGIQERIQNGRDFFNYLQ
QARNVGPDHFSHLEDLFRKIHRMDLAMKVREYQDQQMGVNTINTNKIGVAPVGNMIPRPC
PAVSPVTGKQPTMHQMPNVKSPTMVLKSPADFSKPPQPSEPSEPRSPVQAETNLKELVEP
LKRIGMDQEDAMPSYPMNQRPRGIALIIGNEHFGGNPLLRDRQGNQKDIEHLQELWSFLN
FQVEIRRDLNSHDIYNVMRKISTLDHSQFDCFVCCLLSHGAHGGIYGTDSELVEIKDITA
LFKGVACPSLYNKPKLFFIQACRGQGFDRGARMQADATEVSPEDALRHNAEPNESHFLLG
YATPPGYVSWRSQIHGSWYISKLCEVFRNCCERFDVTSMMVKVNDEVSEAFTKMGYKQCP
APVVTLRKRIYFNNN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggaatctgagggtgcacttcgaagaaatccttccgaagcgaactaccgaggatttctc
atgacgctttctgatgagttaaccaaagagaacgttgagtcgttgaagtatattgcggat
ctaccttatggaattcaagaaaggatccaaaatggaagagacttctttaattacctgcag
caggctaggaatgttggaccagaccattttagccaccttgaggatctctttagaaagata
catcgaatggatttagctatgaaagtcagggaatatcaagaccagcaaatgggtgtaaat
acaatcaacaccaataaaataggtgttgcaccagttggcaacatgataccaagaccttgt
ccagctgtctcaccagtaacagggaaacaacctacaatgcaccaaatgcctaatgttaag
tccccaacaatggtgctgaagtcccctgctgacttctccaaacctcctcaaccttcagag
ccttctgagccacgttctcctgtccaagcagagaccaacctaaaggaattggtagaacct
ttgaagcgtattggaatggaccaggaagacgcaatgccttcgtatcccatgaatcagcgt
ccccgtggtattgctctgatcatcggcaatgagcattttggagggaacccgttactgaga
gatcggcaagggaatcaaaaggacattgagcacctccaggaactgtggtcgtttttaaat
ttccaggtagagataaggcgtgacctgaactcgcatgacatctacaacgtcatgcgaaag
atatcaaccctggatcacagtcagtttgactgttttgtttgttgcctgctaagccatggt
gcacatggaggaatctatggtactgactctgaactagtggagataaaagatatcacggcc
ctcttcaaaggagttgcatgtccctctctctacaataaacccaaattgtttttcatccaa
gcttgcagaggtcaaggttttgataggggggcacgtatgcaggcagatgccacagaagtt
agccctgaggatgcattacgacacaatgctgaacccaatgagagtcattttctccttggc
tatgccacccctccaggttatgtaagctggcgaagccaaattcatggatcgtggtacatc
tcaaaactctgtgaagttttccgtaactgctgtgagcgcttcgatgtcacttccatgatg
gtaaaagtcaatgatgaagtgtccgaggcatttaccaagatgggttacaaacaatgccct
gcaccagttgtcaccctcaggaaacgcatctatttcaataacaactga

DBGET integrated database retrieval system