KEGG   Acropora digitifera (stony coral): 107336647Help
Entry
107336647         CDS       T04352                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00052  Galactose metabolism
adf00500  Starch and sucrose metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107336647
   00500 Starch and sucrose metabolism
    107336647
Enzymes [BR:adf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107336647
    3.2.1.20  alpha-glucosidase
     107336647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107336647
NCBI-ProteinID: XP_015757203
LinkDB All DBs
Position
Un
AA seq 701 aa AA seqDB search
MAAIYLEQVLSLFLLCSLLHSAFSELRNTRSKQRSVSDQSKIDCYPEMGASRASCQSRGC
TWEERSEKGIPWCFFPQGYRGGYRIEETVQVTKLGYQARLKRRSDITIYDKAIDEVGLDV
EFQTEDRLRFKLYDSRNKRYEVPVPMPKATEKAVNPKYKVEFKGDPFSLKISRKDNGAVL
WDSSVGVFIFEDQYLQISTKPPSSFVFGFGEQEHKSFKHNLSAWEVLPIFTRDQFPFNGG
NLYGHHPFYTCMENDGKAHGVFLLNSNAMEIALQPEPAITYRTIGGILDFYIFLGPTPEE
VIMQYTEVIGRPFLPPYWSLGFQLSRWGYNRIETVKNLVKSMRQYDIPQDVQYGDIDYMT
RQKDFTYDPANFKGLPEFVQSIKKDGLRYIIILDPAIGANDSNYQPYDLGNELNVFIKDG
DTGGNLYGKVRKYLITTIIPLVSFVAVFRDLNNTLRQHYVDILAGIIGNIMADKTVCMNA
KQANDIHYNVHSLYGWSQTLITIEAARNSTGKRSVVISRSTFPSSGKYAGHWLGDNKASW
DQLHKSIIGMLEFNLFGIPYIGADVCGFFDHPTKEMCLRWTQLGAFYPFSRNHNGFGNKA
QDPTAFGVEFAKDARKVLQIRYRLLPFLYTLFYKANTDGSTVVRPLMHEFPKESVTWEID
RQFLWGPNLLISPVLEKGKTSVEAYFPDSRWYSYYTVNNVV
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatctacttagagcaagtacttagtcttttccttttgtgttcactgttacat
tcagcattcagtgaactgagaaatacaagatcaaaacagaggtccgtttcagaccagagt
aaaatcgactgttatccagaaatgggggcaagtcgagcgtcctgccaatctcgcggatgc
acatgggaggaaagaagcgagaagggcattccttggtgcttcttcccacaaggatatcgt
ggtgggtacaggatagaggaaaccgtgcaagtcacaaaattaggttaccaagccagatta
aaacgacgctccgacattaccatatatgacaaggccattgatgaagtcggacttgacgtt
gagtttcagacggaagatcgcctgagattcaagctatatgactcaagaaataagagatat
gaagtacctgtaccaatgccaaaagcaacagaaaaggcggtcaatccaaagtacaaggtt
gaattcaagggcgacccattctctttgaaaatatcgcgaaaagataacggtgctgtactg
tgggattcctctgttggtgtgtttatattcgaggaccagtacttgcaaatctcgaccaag
cctccctcgtcatttgtattcggctttggtgaacaggaacacaagtcattcaaacacaac
ctgtctgcttgggaggttctgcctatctttacgagagaccagttcccttttaacggggga
aatttgtatggacaccatcccttttatacctgcatggaaaacgatggaaaagcacatgga
gtttttcttttaaacagcaatgcaatggaaattgctcttcaacccgagcctgccatcacg
taccgtactattggaggaatcctagatttctatatttttcttggccctacccctgaagaa
gtcataatgcaatacaccgaggtgatcggtcgtccatttttaccgccatattggtcccta
ggattccagctatctcgatggggctacaacagaattgaaacagtcaagaacctggtgaaa
agcatgcgacagtacgatatcccacaggatgtgcaatatggcgatattgactacatgacc
cgacaaaaagacttcacctacgaccctgctaacttcaagggtttgcccgagtttgttcaa
tcaataaagaaagatggattacgctatattatcatactggatcctgcaattggagctaat
gattccaattatcagccttatgatctaggaaatgaattaaacgtgttcatcaaagatggt
gacactggagggaatctctatggaaaggtgagaaagtatcttatcacgactatcattcca
ttagtctccttcgtagctgtctttcgtgacctcaacaatacgttaagacaacattacgtt
gacatccttgcagggataataggaaacatcatggctgataaaactgtctgtatgaatgca
aaacaggccaatgatattcactacaacgtccatagcttgtatggctggagtcaaactctt
attaccattgaagcagcaaggaacagcacgggaaaacggagtgtggtcatctcaagatca
acgtttcctagtagcggcaaatatgccggacattggttgggagataacaaggcatcatgg
gaccagcttcataagtcaatcattggaatgctcgagttcaatctctttggaataccttac
attggagctgatgtttgtggtttctttgatcatccaacgaaagagatgtgcctccgctgg
acacagcttggggcgttttatccattctcgagaaaccataacggatttggaaacaaggct
caagatccaaccgcatttggcgtcgaatttgcaaaggatgctcgtaaagtgttacagata
cgttacagattattgccattcctttacacactgttttacaaggcaaacacagacggatcc
acagtagtcagacctctgatgcacgagttcccaaaggaaagtgtcacgtgggaaattgat
cgacagttcctatggggtccaaatttactgatctcacccgtcttagaaaagggaaagacg
agtgtcgaggcctattttccagactctcgttggtacagttattacacggtaaacaacgta
gtgtaa

DBGET integrated database retrieval system