KEGG   Acropora digitifera (stony coral): 107336821
Entry
107336821         CDS       T04352                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:adf04052]
    107336821
   00536 Glycosaminoglycan binding proteins [BR:adf00536]
    107336821
Cytokines and growth factors [BR:adf04052]
 Growth factors
  Growth factors (RTK binding)
   107336821
Glycosaminoglycan binding proteins [BR:adf00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107336821
SSDB
Motif
Pfam: FGF Fascin DUF5122
Other DBs
NCBI-GeneID: 107336821
NCBI-ProteinID: XP_015757373
LinkDB
Position
Un
AA seq 218 aa
MRGRQQRKQVRNLARFLQVVLTNGLWWLLLLSIIVTITICESHPEGSQRQRAGSGSDQDS
EVEETNDTEQEIYRRLTDPHVDKSSYKKVGAYLRTGKLFNRNGYVLRINADGTVDGTTER
NSPFARLEFHSVGTGLLMMLGIASQRYLSISDNGRLQGVVEPSRNTVFREVHETNWYHSY
FSYEHSGWLIGIKKNGRAKRGQLTRIGQKSTQFLITYD
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagaggaagacaacagagaaaacaagttagaaatttagcaagatttttgcaagtcgta
ttgaccaatggcttgtggtggttattattattgagcataatagtcactataactatttgt
gaatctcacccggaaggatcccagagacagagggcggggtccggttcggaccaagactca
gaagttgaagagaccaatgacacagaacaggaaatatatcgaaggctgacagatccacac
gtggacaaaagctcatacaaaaaagtaggagcttacttaaggacaggaaagttgtttaac
cgaaatggctacgttctgagaataaatgctgatggtacggttgatggaacaacagaaagg
aattcgccgtttgcgcggttggaattccattcagttggaaccggtttactaatgatgttg
ggcattgcaagtcagagatatttgtcgataagcgacaacggacgtcttcaaggagttgtg
gaaccctcgaggaatactgttttccgagaagttcacgaaactaactggtatcactcttat
ttctcttatgaacatagcggatggctcatcggtataaagaaaaatggaagagcaaaacga
ggacagttaacgagaatcggtcaaaagtcgacgcagtttttgatcacatacgactaa

DBGET integrated database retrieval system