KEGG   Acropora digitifera (stony coral): 107338459
Entry
107338459         CDS       T04352                                 

Definition
(RefSeq) fibroblast growth factor 16-like
  KO
K18496  fibroblast growth factor 1
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:adf04052]
    107338459
   00536 Glycosaminoglycan binding proteins [BR:adf00536]
    107338459
Cytokines and growth factors [BR:adf04052]
 Growth factors
  Growth factors (RTK binding)
   107338459
Glycosaminoglycan binding proteins [BR:adf00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107338459
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107338459
NCBI-ProteinID: XP_015759182
LinkDB
Position
Un
AA seq 249 aa
MLQICTKTKWLLQNCPLQNSGIHVTDDDQLLKMDGFHLLLLFLLLCFAKTKTTAMRGNDA
KSHSMDEKETKNSLTRSVKGDKDGHRAVFLFSQKWPSRLSGDNFLRRVRKITKRPTTTTQ
CKIFCRSGYHLEILPNGMVRGTVDQESKYVLFEMQSFGPSLVKLMGITTGRYLVMRRNGT
LHGLRNRRSRDSLFKETHEQNAFHSYASHRFYRKKPYDMLVGIKRNGQIKRATKTVHGQT
ATQFLVIKL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcttcaaatttgcacaaaaacaaagtggttgcttcagaattgcccgctccaaaacagt
gggattcacgttactgatgatgatcaactcttaaagatggacggattccaccttctgctg
ttatttctactcttatgctttgcgaagacaaaaacgacggcgatgcgtggaaatgacgct
aaatctcattctatggacgagaaggaaacaaaaaactcactgacaagatcggttaaaggt
gacaaagacggacacagagctgtttttttgtttagtcagaaatggccttcacgattatcc
ggtgataatttcttgaggcgagttcgcaagatcaccaagcgtcctaccacaacaacacaa
tgtaaaatcttctgtagaagtgggtaccatctagaaattcttcccaatggtatggtgaga
ggcactgttgaccaggaaagtaaatacgttctttttgagatgcaatcttttggtccaagt
cttgtcaaattgatgggaataaccactggcagatatttggtgatgagaaggaacgggacg
cttcatggactgcgcaatcgccgcagtcgagattcgctgttcaaagagacgcacgagcaa
aacgccttccattcttacgcatcacacagattctacagaaaaaaaccctatgatatgttg
gtaggaataaagagaaatggacaaataaaacgagctaccaaaactgttcatggacagacc
gctacacaattccttgtcatcaaactttaa

DBGET integrated database retrieval system