KEGG   Acropora digitifera (stony coral): 107338579
Entry
107338579         CDS       T04352                                 

Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1 homolog
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107338579
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     107338579
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107338579
SSDB
Motif
Pfam: Ig_3 Ig_2 Peptidase_C14 I-set ig V-set Ig_5 Ig_4 MALT1_Ig Ig_6 Izumo-Ig CHAT C2-set_2
Other DBs
NCBI-GeneID: 107338579
NCBI-ProteinID: XP_015759307
LinkDB
Position
Un
AA seq 655 aa
MALLNDLGQQCKTTRQLVVWLKEIENDDALEILGYVEEVEITEQPKSQPVRAGGSIILRC
KAKGFPKPQYQWYKDNQLIQDGIDMELTIDHAEMKDSGTYKCIVSNQTETVKSNCVEVQV
LPFAQNGLDAQRSLPPQAKHPPVIIQQPQSCYVPVGHPFSLSCEVVESPVAYQWYKDGFL
LLGETGPVLEFQPFYYRHEGNYTCRVENSAGDALSNIATLEASLPNGYGPLDFHSAVHGR
PAHLKQKATDKIALVIGNRDYVHLPLDESPLVHTCSDAKMLASILRKPEMGFKVISLMNL
TRDEMTEALKKFYSLLGEGVYGLLYFAGHGFEQGGQNYLVPVDAGHWIPEKAVCAQKVLK
EMNKFHTELIVFLLDICRKRANVDTSFTLECHDFPHDAQAVLGFATCPQSEAYERRQDPN
GMYMKHLLKHITKDVKVEDVLHEVAGDVEAEVESNQWINRQRPQYHTTTTRSYSLCDQIA
PDQSSEGRQKLWHEIHRLPHKREIEIDSGIWIELFFEHLNWLSNAVVICLRVAELGEATM
CEANLNYDSLPKDVQNIHFHRTTTNVLRQVVQNSPEAENGIVARAWRDGGGRESPSKCPV
ESISDIYNIQRLKQPLGLTITVKYVLNGSHVDRTKHIVEVFHSKEFGIAAAFFND
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccttgttgaatgacttgggtcagcaatgcaaaactactaggcagttggttgtatgg
ctgaaagagatagagaatgatgatgctttagaaatcttgggatatgttgaggaggtggaa
atcacagagcaacccaagtcacagccagtacgtgctggtggaagcattatattgagatgc
aaggccaaaggtttcccaaagccacaataccagtggtacaaagacaatcaattaatacaa
gatggaatagatatggagctcactattgatcatgctgagatgaaagacagtggaacgtat
aaatgcatagtgtcaaatcaaactgaaacagtaaaaagtaattgtgtggaggtacaagtg
cttccttttgcgcaaaatggtttggatgcccaacgtagtcttcctccacaagccaaacat
ccaccagttatcattcagcagccacaatcctgttacgttccagtgggacatccattcagc
cttagttgtgaagtagtggaatcaccagtggcttaccaatggtacaaagatggctttctg
cttctgggagaaactgggccagtcttggaattccagccgttttattacagacatgaaggc
aactacacctgccgagtagagaacagtgcgggtgatgcccttagcaatattgctactctt
gaagcttcgcttcccaatgggtatggacctcttgatttccattcagcagtacatggcaga
ccagcccatcttaaacaaaaagccactgacaagattgccttggtcattggcaatcgtgac
tacgtgcatttgccgttggatgagagccctctggtccacacctgcagtgacgcaaagatg
ctggcatcaattttgcgcaagccggaaatgggttttaaagtgatctccctcatgaacttg
acccgagatgaaatgacggaagctctcaagaagttttacagcctcctgggtgagggagtg
tatggcttgttatactttgcaggtcatggatttgaacaaggaggtcagaattacttggtt
cctgtagatgcagggcattggattcccgaaaaagctgtatgtgcacaaaaagttttgaag
gagatgaacaaatttcacactgagctgattgtcttccttctagatatttgccgcaagagg
gcaaatgtagacacaagttttactttggagtgtcatgatttccctcatgatgcacaagct
gtcctgggttttgccacctgtccccagtcagaggcatacgaaagaagacaagatccaaat
ggaatgtacatgaaacacctgctaaagcatatcacaaaggatgtcaaagtggaagatgtc
ttgcatgaagtggctggagatgttgaggctgaagtggaatctaatcagtggatcaatagg
cagcgtccacagtaccataccacgacgaccagaagttacagcttgtgtgatcaaattgcc
ccagatcaaagttctgaagggagacagaagctgtggcatgaaattcacagactcccccat
aagcgagagatagagatagactctggcatttggatagagctgttctttgaacacctgaac
tggttgtccaatgcagttgtgatatgcttgagagtggctgaacttggagaagcgacaatg
tgcgaggcaaacttgaattatgattccttgccaaaggatgtacaaaacattcacttccat
cggacaacaaccaacgtattgagacaggttgtgcagaattccccagaagctgagaatgga
atcgttgcacgggcgtggcgggatggtggaggacgtgaaagtccatccaaatgccctgtg
gagagtataagtgatatttacaacatacaaagactcaaacaaccgcttggcctgacaata
actgtaaaatatgttcttaatgggtcacatgtggatcgaaccaaacacatcgtggaggta
tttcacagcaaagaatttggaattgctgcagctttcttcaatgactga

DBGET integrated database retrieval system