KEGG   Acropora digitifera (stony coral): 107339872Help
Entry
107339872         CDS       T04352                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04068  FoxO signaling pathway
adf04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:adf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107339872
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107339872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 107339872
NCBI-ProteinID: XP_015760691
LinkDB All DBs
Position
Un
AA seq 209 aa AA seqDB search
MLPPVMAMAFTQGVTSSSSRRRERPNIVPSRSVCRNLFGPVDHEQLKADLLREKEEIIKE
DTRKWNFDFENDIPLLGRYLWEKMYSDLARERATSSFSSRASEGKATNERSSCTTTTVAE
HPDVTPSATSLDMAHRTIQISDNVDSEKPESEKCDPKMTPRKLRSRSSTGKITDFLRPRK
QRRSVKRLQLKTRESTSKQTSLDVLFRKH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccccagtcatggcaatggcttttacacagggagtaacttcgtcttcatctcgt
cggagagaaagaccaaacattgtcccctcaaggtcggtctgcagaaacctgtttggcccg
gtcgatcacgagcaattgaaagcagatttacttcgagagaaggaagaaattatcaaggaa
gacactcgaaagtggaacttcgattttgagaatgacattccgttgcttggaagatatctt
tgggaaaaaatgtactctgacttggcaagagagcgagcaacctcaagtttttcttcccgt
gcaagcgaagggaaagcaacaaacgaacgctcaagttgtactactactacagtcgccgaa
caccctgatgttactccttcagcaacaagtttggacatggcacatcgtacgatacagata
tcggataacgtagacagcgagaaacctgaaagtgaaaaatgcgacccaaaaatgaccccg
aggaagctcagaagtaggagctcaacaggaaaaattacagattttttgcggccgcggaaa
caaaggcgatctgtcaaaaggttacagctcaaaacgcgagaatcaacatcgaagcaaaca
agtttggacgtgttatttcgcaaacattaa

DBGET integrated database retrieval system