KEGG   Acropora digitifera (stony coral): 107339872
Entry
107339872         CDS       T04352                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:adf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107339872
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107339872
NCBI-ProteinID: XP_015760691
LinkDB
Position
Un
AA seq 209 aa
MLPPVMAMAFTQGVTSSSSRRRERPNIVPSRSVCRNLFGPVDHEQLKADLLREKEEIIKE
DTRKWNFDFENDIPLLGRYLWEKMYSDLARERATSSFSSRASEGKATNERSSCTTTTVAE
HPDVTPSATSLDMAHRTIQISDNVDSEKPESEKCDPKMTPRKLRSRSSTGKITDFLRPRK
QRRSVKRLQLKTRESTSKQTSLDVLFRKH
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttgcccccagtcatggcaatggcttttacacagggagtaacttcgtcttcatctcgt
cggagagaaagaccaaacattgtcccctcaaggtcggtctgcagaaacctgtttggcccg
gtcgatcacgagcaattgaaagcagatttacttcgagagaaggaagaaattatcaaggaa
gacactcgaaagtggaacttcgattttgagaatgacattccgttgcttggaagatatctt
tgggaaaaaatgtactctgacttggcaagagagcgagcaacctcaagtttttcttcccgt
gcaagcgaagggaaagcaacaaacgaacgctcaagttgtactactactacagtcgccgaa
caccctgatgttactccttcagcaacaagtttggacatggcacatcgtacgatacagata
tcggataacgtagacagcgagaaacctgaaagtgaaaaatgcgacccaaaaatgaccccg
aggaagctcagaagtaggagctcaacaggaaaaattacagattttttgcggccgcggaaa
caaaggcgatctgtcaaaaggttacagctcaaaacgcgagaatcaacatcgaagcaaaca
agtttggacgtgttatttcgcaaacattaa

DBGET integrated database retrieval system