KEGG   Acropora digitifera (stony coral): 107339980Help
Entry
107339980         CDS       T04352                                 

Definition
(RefSeq) SWI/SNF complex subunit SMARCC2-like
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:adf03021]
    107339980
   03036 Chromosome and associated proteins [BR:adf03036]
    107339980
Transcription machinery [BR:adf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107339980
Chromosome and associated proteins [BR:adf03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    107339980
   PBAF complex
    107339980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_1 SWIRM-assoc_3 Chromo Myb_DNA-binding Myb_DNA-bind_6 DUF2618
Motif
Other DBs
NCBI-GeneID: 107339980
NCBI-ProteinID: XP_015760824
LinkDB All DBs
Position
Un
AA seq 1190 aa AA seqDB search
MAARKKDGAPDWKYYETAETAALFEPVKQYLLKNCKKYVQMEPPTNKTLATLTAQLLQFQ
EDNFGKDVSKQALLTKLPMKMFMDYSSGGSLCVILANVFKTKMEQGWRRFDFQSPSRMDR
NVELFLNIEKALKEAKLLTVPQVYIMPDIDAKLAAKLRDIVKRHNGAITDDKAAATHVVH
EPPPPFPEDEWLRPLLKQDNQVLVHWWYYPDSYDTWVPSGNIEDEPQPEPQHQGPWQVNA
RWLSDLDVFNEWMNEEDYELADTDGSGNKRETSPALGKTRRKSLRPGTSSDEQPGSPDGG
IFFAKLLTVPQVFIMPDIDAKLAAKLRDIVKRHNGAITDDKAAATHVVHEPPPPFPEDEW
LRPLLKQDNQVLVHWWYYPDSYDTWVPSGNIEDEPQPEPQHQGPWQVNARWLSDLDVFNE
WMNEEDYELADTDGSGNKRETSPALGKTRRKSLRPGTSSDEQPGSPDGGKLKKRKRSPSP
DPKKKKKLVTPANPKKKSGKEEDNDRYKSDFFNQCEVEEVAGSTVSASKGKEIDLQPMKG
NALTDISESGKPDDGDGDEGESGSQMDTQEQTEESAEQSAPTSPSSSQQKDGLFKEPLSV
HDTEPHDENLTEQTHHIIIPSYASWFDYNSVHAIERRAIPEFFNGKNKSKTPEVYLAYRN
FMLDAYRLNPTEYLTATACRRNLAGDVCAVVRVHAFLEQWGLINYQVDADGRPTPMGPPS
TSHFHVLLDTPAGLQPLQPAKTQVQSIYNTVTTRAQVRVGCVSCFRSLFFQGLEMFKDDW
NKVAEHVGTRTQDECILHFLRLPIEDPFLEDVQLGPLCHQPVPFSQQGNPIMSTVAFLAS
VVDPRVASAAAKAALEKFSEMKEEIPQAVIDSHVKNATNRSEKRKVENATDENSSTEEKP
QPMEVNGSESTGADGGETGTQNVKMEESNEADKETENGDKSKTINEENIAKAAAASLAAA
AVKAKHLAQVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLA
ERQQFHQEQLKAAEIRARASSGHLSPSQSSPGQIQPQSQVSQPPPQFSQQQQVQIQPQQR
PSQQVSVVPTGQMPQVSSPAQPGQIGSNPPSASPSPAPPMNPGSVAQMGSLPASGCSTPV
SFIGSNAASPASGPGTPSSAPQGHASSGQVAHGPGDAVASPVPPPSGMME
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtaagaaagatggcgctcctgattggaaatattatgaaacggctgaaact
gcggctctttttgagcctgtaaaacagtatttgcttaaaaactgtaaaaagtatgtgcaa
atggaacctccaacgaacaagacgttggccacacttactgcacagttgttacagtttcaa
gaagataactttggtaaagatgtcagcaagcaagcccttctcacaaagctacctatgaaa
atgttcatggattactcctctggtggaagtctttgtgttattcttgcaaatgtattcaag
acaaaaatggaacaagggtggaggagatttgacttccagtcaccttcacgtatggatagg
aatgttgaactcttcttgaatattgaaaaagctctcaaggaggcaaagttattgactgtc
ccacaagtgtatataatgcctgacattgatgccaaacttgcagcaaagctcagagatatt
gttaagaggcacaatggtgccatcactgatgataaagctgctgcaactcatgtcgtacat
gaacctcctccgccatttccggaagatgaatggttacggccactattaaaacaggataat
caggttcttgttcattggtggtattaccctgacagctatgatacttgggtcccatctggc
aatattgaggatgagcctcaacctgaaccccaacaccagggaccctggcaggtgaatgct
cgctggctttctgatcttgatgtgtttaatgagtggatgaatgaggaggattatgaatta
gcagatactgatggaagtggcaacaaaagagaaacttccccagcattaggaaaaacaaga
aggaagagtttgagaccaggaacaagttctgatgaacaacctggcagtccagacggaggt
attttctttgcaaagttattgactgtcccacaagtgtttataatgcctgacattgatgcc
aaacttgcagcaaagctcagagatattgttaagaggcacaatggtgccatcacagatgat
aaagctgctgcaactcatgttgtacatgaacctcctccgccatttccagaagatgaatgg
ctacgaccgctactaaaacaggataatcaggttcttgttcattggtggtattaccctgac
agctatgatacctgggttccatctggcaatattgaggatgagcctcaacctgaaccccaa
caccagggaccctggcaggtgaatgctcgctggctttctgatcttgatgtgtttaatgag
tggatgaatgaagaggattatgaattagcagatactgatggaagtggcaacaaaagagaa
acttccccagcattaggaaaaacaagaaggaagagtttgagaccaggaacaagttctgat
gaacaacctggcagtccagacggagggaaattaaagaaaagaaagaggtcgccctcacca
gacccaaaaaagaaaaagaagctggtaactccagcaaatcccaagaaaaagtcaggaaaa
gaggaagacaatgataggtacaaatcagactttttcaaccaatgtgaagttgaagaagtt
gcaggttcaactgtatcggcttcaaagggaaaagaaattgatctgcagccaatgaaagga
aacgcgttgaccgacatctcagaatcagggaaaccagacgatggtgatggagatgaggga
gaatcaggaagtcaaatggatacacaggaacagacggaagaaagcgccgagcagtcagcc
ccaacttcaccttcatccagccaacaaaaagacggattattcaaagaaccacttagtgtg
cacgacacagaaccacatgatgaaaacctgacagagcaaactcatcacatcattattcca
agctatgcttcttggtttgattacaacagcgttcacgccattgaacgaagagctataccg
gaatttttcaatgggaaaaacaaatccaaaacaccagaagtgtatctggcgtatcgcaac
ttcatgctggatgcttaccgtctcaaccccacagagtacctcacagcaactgcttgtcga
cgaaacttagctggagatgtgtgtgctgttgtcagggtccatgctttcttggagcagtgg
ggtctcatcaattatcaagtagacgcggatggtcgtcccacgccaatgggtcccccctcg
acttctcatttccatgtgttattagatacgccagcgggccttcagcctctccaacccgcc
aagactcaggtacagtcgatctacaataccgtaacaacacgggctcaagttcgtgtaggc
tgtgtttcatgctttcgttctttgttctttcagggactggaaatgttcaaagatgactgg
aacaaggtggcagaacacgttggaactcgaacacaagacgaatgcattttgcattttctg
aggctaccaattgaagatccgttcttagaagacgtccagctgggtcccttgtgtcaccag
ccagttccattcagccaacagggaaaccctatcatgtctacagtcgccttcttggcttca
gttgtcgacccacgagtggcaagcgcagctgccaaagcagctttggagaaattttcggaa
atgaaagaagagattcctcaggcagttattgacagtcatgtaaagaatgcaacaaatcga
tcagaaaaaaggaaggtagagaatgccactgatgagaattccagcacagaggaaaaacct
cagccaatggaggtcaacggaagtgagtcaacaggagctgacggaggagagactgggaca
caaaatgtgaagatggaagaatctaatgaagctgataaagaaacagaaaatggggataaa
tcgaagaccatcaacgaagaaaacatcgccaaagctgcagcggcttctctggcagctgct
gctgttaaagcaaagcatttggcacaagttgaagagagaaagatcaagagccttgtggca
ttgcttgtggaaactcaaatgaagaaactggaaataaaacttcgacattttgaagaactt
gagaccatcatggatcgggagcgcgaggcgctcgaataccagcgtcaacagctcctcgcc
gagcgccagcaattccatcaagagcaactgaaggctgctgagatacgcgcacgcgcatcg
tctggtcacttgtccccttcacagtcctcccctgggcagatccaaccacagtcacaggtt
tcccagcctcctccccaattctctcagcagcaacaggtgcagatacagccacaacaaagg
ccatcccagcaagtttctgtagttcccacaggccaaatgccacaggtctccagtccagct
cagcccggtcaaatcggatccaatcccccatctgcctcaccatcaccagcgccacccatg
aatccgggttctgtagcccaaatgggctccctccctgcctcgggttgtagcactccggtg
tctttcattggatccaatgcggcatctccggcttctggcccgggtaccccgagttccgcc
ccccaaggacatgcctcttcgggacaagtggctcacggtccgggtgatgcggtcgcaagt
ccagtccctccgccctctggcatgatggaataa

DBGET integrated database retrieval system