KEGG   Acropora digitifera (stony coral): 107340719Help
Entry
107340719         CDS       T04352                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:adf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107340719
Enzymes [BR:adf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107340719
Chromosome and associated proteins [BR:adf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107340719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 107340719
NCBI-ProteinID: XP_015761585
LinkDB All DBs
Position
Un
AA seq 1802 aa AA seqDB search
MVLELRLHSPAGAEPLVYSWPLQKSDGRDEAAEIVETIRWVCADFPELKLAVENYVLREF
EPSSFESMNKLCERYNRAIDGILQLWKGCAPPMCINVPPSQELLRHIIQQVYIRSVKDPE
KLNDYEPFSPEVYGETSFELVAQMIKEVPMSSDDLFIDLGSGVGQVVLQVAASGNVRECY
GVEKAEIPAKYAEDMDREFRKWMSWFGKTHKPYKLERGDFLETKMKEKIQSAGVVFVNNF
AFGPGVDHKLKERFASMREGAKIISSKAFCSLNFRTTSRNLSDIGTILRVSELKPNGRAV
SWTGRPVSYFVHEIDRTLLEQYFADLKRRKEGRDFSDVSSLSDSMASTPNVEELDDVLFG
VSTRQQWNQLINHIEATNHANKSGRRKHDKKGNVLLQEENSNVIVVEQDQDQKGWTKGRQ
PTFAQKVRRKYQKQQNKKAQKLNKEEKTTRGKGRPRQNPRPKKGNTMTKVKTKQPSKASQ
KRQKDSLAVTALENATVAALQSLGKKSGHVRGMRISSASPPPFMNVVNMEQCVPALDKLL
EVFRFQYLHFLCHMQSSQYKENLKHQIEEQKERKKELSGKVNQAEKVVDSLQKEALGNLK
MRMNEIGLSAKTPRELLMKAGELLGEHKKMKDKVKRLEREVKHLEKHKGQQAKENKPSSG
NVDVSPKTAADSQAKVQENLINHLYEELAKRKALVEKVNKLESEVDRLDSVKAGSTEKSV
LSSCPSPSGNSSVNVKPCVPNIKAVLAPYPAGSSPLVSNALVNRLSPGTPGASSASVLLS
GVPVSQHGSLQPQIVTTPPSLLRPVVGVPVQMVSCVDKDGKLVSPSHKTKPTKQIGNVKK
KPRANKHSPKPLSSQASSTAASPSTPAVPMLQSPSVSRPHQPLLTSPLARSGGEPSSVTV
VTSPVTPTPVRRVTSDFSSVVPLPGASSASQRPTGDVPPMVSFVQNGLSYISPLSPLSSV
SVTARPPTSCSTPLSSLSASTEKYLNTFTTQSTATPKAAFSNNTSHSPTVSNSSSHTSYS
NRSPYLNTDLSTDHSAGIKLLCDLLNDTLPEQPPPLIAASLAVRSLGTPSSVQASTLIPD
SSKGVEKKQADSPLLHASKSGSNSPRTPLLRNTATSPSPEKVSSPLQQTPLVEKSPSSSE
TPVTKKKRTSPFSIENLVSSSPESQSGKKNLDEPQSARRNQSPADISNGSSPKGKNKSPS
TNFSIAHITRDINTANNKCVSPSVTGSLASSAPVPEEVSKRYRRRSPPEPRISNPESNGT
GIGAADADNSATDSVGSTRVDNRQRVLAPLARVCGPSTEKLSQSGLVSKELSSVEKMTDL
THQLGSPKIPSASTSCTSATSTPKDQIVSNDMSSTSSSSNKISSSGVSDHERNSSAIVEL
SASVIPDIPLDLIPLPRGKRPSPEKGTNQTAPSRKKRRSPVPAVPKSKSPDSEVSSLMTN
ESLPPSSSIASSVSKSEAAVLEGQAPVLVDSNPCSARSPIPVAPSTVLQPHAGVSLPSFR
SVFSLPKEGAAAPEDSTQLDSGVQHSEKHTQSKKEVSELSGKRRKRKEKKKVPGKAKGAL
SLLMQYDSDSQSSGGTHTESDDSGSGHSTSPVNLSLSPVVVETTDPSRNLSSGASPVGNE
TSGSGVHMNGAGAGLKSSEPVTHKKRPSDGKSPLEKKKGKTVAGSERTVGNRPSPFVNLH
DTVVSMQQLQAVAPVMSMPANYQPFSSGYANYPPPGQHGCVMPRFSLQPSSLSLTSGART
HVQYTANRPRGYPAESNTGPPRYHASPRGYFPQWRTSFAPMPCQGPPFKFSNNGNNGNNV
FR
NT seq 5409 nt NT seq  +upstreamnt  +downstreamnt
atggttcttgaattaaggcttcatagtccagccggagcggagcccttggtatattcatgg
ccactgcagaaatcggatggaagagatgaagccgccgaaatcgtggagacaatcagatgg
gtttgtgccgatttcccagagctaaagcttgctgttgagaactatgttctcagggagttt
gagccaagcagctttgaaagcatgaacaagctttgtgaacgatacaaccgagcgatcgac
ggaattttgcagttgtggaaaggttgtgctccacctatgtgtataaatgtacccccttcg
caggaacttcttcgtcatattatacaacaggtgtatattcgttcagttaaggacccagag
aaacttaatgattatgaaccattctctcctgaggtgtatggagaaacatcatttgaactt
gtggcacagatgatcaaggaggtacctatgagttcagatgatctctttattgatctcgga
agtggtgtcggtcaagttgtgttgcaagtggcagcttctggaaatgtaagagaatgttat
ggtgtggagaaagcagaaatacctgccaagtatgctgaggacatggacagagaatttcgg
aaatggatgtcttggtttggtaaaacacacaaaccttataagcttgaacggggggatttt
cttgaaactaagatgaaagagaagattcagtctgcaggagttgtgtttgttaataacttt
gcttttgggcctggtgtggatcacaaattgaaagaacgttttgcctccatgagagaaggt
gctaagatcatttcgtcaaaagcattttgctcattaaacttcagaaccacttcacgtaat
ttatcagatattggtacaattctgagggtatctgaactcaagccaaatggacgtgcagtc
tcttggactggcagacctgtttcatattttgtgcatgagattgataggactttgcttgag
cagtattttgcagacctgaagagaagaaaggagggcagagacttcagtgatgtaagcagc
ttgagtgattctatggccagcacaccgaatgttgaagagttagatgatgtgctctttggt
gtctccacacggcaacagtggaatcaactaatcaatcacatagaagccactaatcacgca
aataaaagtggcaggaggaaacacgacaagaaaggcaatgttttgctgcaagaggagaac
agtaatgtaattgttgttgaacaagatcaagatcagaagggttggacaaagggacggcaa
ccaacttttgctcaaaaagtaaggcgaaaatatcaaaaacaacaaaacaagaaagcacag
aagctaaataaggaagaaaaaactacaagaggaaagggaagacctcgacagaatccacga
ccaaagaaaggaaataccatgaccaaagttaagaccaaacagccatcaaaagcaagtcag
aaaagacagaaagattctcttgctgtaacagctctggaaaatgctacagtggctgctttg
caaagccttggaaagaagagtggtcatgtgagaggaatgagaatttcatcagcttcaccg
ccaccttttatgaacgttgttaacatggagcaatgtgtccctgccttggataagctttta
gaggtcttccgcttccagtatcttcatttcctttgccacatgcagtcatctcagtacaaa
gaaaacctcaagcatcaaattgaagaacagaaagagaggaaaaaggaattatctggaaaa
gtcaaccaggcggaaaaagtggtcgattcattgcaaaaggaagctctagggaaccttaaa
atgcgcatgaacgagattggtttgtctgccaagacaccacgtgagttgctcatgaaagcc
ggggagctgttgggagaacacaagaaaatgaaagacaaagtgaaacggcttgaaagggag
gtcaaacacctggaaaagcacaaaggccaacaagcgaaagagaacaaaccttcaagcgga
aatgttgatgtttctccgaaaacggcagctgactcacaagctaaggtccaggagaatctc
ataaatcacctctatgaagagctagcaaagagaaaagctttggtggagaaagtgaacaag
ttggagagtgaggtagatagactggattctgtgaaagcaggcagcactgaaaaatctgtg
ttatcttcttgcccttcacctagtgggaattcttcagttaacgttaaaccttgtgtacca
aacatcaaagcagtcctggctccatatcccgccggctcgtctcctttggtatcgaatgcg
ctagtcaaccgtttgtccccagggacaccaggagccagttcagcgtctgtgctcttgtcg
ggtgtgcctgtgagccaacatggatccttgcaaccccagatcgtaacaacacctccgtct
cttttgaggcctgtcgtgggtgtccctgttcagatggtctcttgtgttgacaaagatgga
aagttggtctcgcccagtcataaaacaaaaccaactaaacaaataggaaatgtgaagaaa
aagccgagagccaataaacattcccctaaaccactatcctctcaggcatcaagtacagcg
gcgtctccgagcacaccagcagtaccaatgttgcagtcaccaagcgtctctcgtcctcat
caaccactgttgacgtctccacttgctcggtccggaggtgaaccaagctcggtaactgta
gtgacgtcacctgtcacgccaactcctgtcaggcgcgtgacaagtgatttttcctcagtg
gttcctttacctggggcatcgagtgcgtcacagaggcctactggtgatgtacctccaatg
gtgtcgtttgtccagaatggtctctcgtatatctcaccactgagtcccttgtcaagtgtg
tctgtcactgctcgtccacccacctcttgttccacaccgctgagttctctttctgcgtcc
acggagaagtacttaaacacgtttacaacacagagcactgcgactcctaaagctgctttt
tctaataacacatcacacagtccaaccgtctccaacagtagtagtcatacttcgtattct
aatcggtctccatatcttaatacagacttgtctacagatcacagcgcaggcatcaagtta
ctgtgtgatctactcaacgacacgttacccgaacaacctccaccgcttatagctgcatct
cttgctgtgcgttctctagggacaccttcctcggtccaagcatctactttaatcccagac
tcttccaaaggcgtggagaagaaacaggcagattctcccctactacacgctagtaagagc
ggatcaaattccccaaggacccctctcttgagaaacaccgcaactagtccgtcgcctgaa
aaagtttcatcccctttacaacaaacgcctttagttgaaaagagcccttcaagtagcgaa
acacctgtaacaaagaagaagaggacttcaccattttcgattgaaaacctcgttagttca
agcccggagtctcaaagtggtaagaaaaacctcgatgaacctcaaagtgcgagaagaaac
caaagccccgccgacatctccaacggaagcagtcccaaaggtaaaaacaaatcaccttcg
acaaattttagcattgcgcacattactcgggacataaacaccgccaacaataaatgcgta
agtccatctgtgacgggatctcttgcgagttcagctcctgtgcccgaagaagtgagcaaa
cgatatcgaagaaggtcgcctccagaacctagaatatcgaatccagaatctaatggaaca
ggcatcggagctgctgatgccgataacagcgctacagattctgtaggaagcacgagagtg
gataaccgacagagagttttggcccctcttgctagggtctgtggcccatccaccgagaag
ctgagtcaatcgggattggtctcaaaagaactttcttctgtggagaaaatgaccgattta
actcaccaattaggaagccccaaaatcccctctgcatccacaagttgtacctcggcgaca
tcgacgcccaaagatcagattgtttctaacgacatgagctctacctcgtcatcttcgaac
aagatatcatcgagtggggtctcagatcatgagagaaattcttcagcgattgttgaactc
tccgcttctgttatccctgatattccacttgatctgattcctcttccaagaggaaaaagg
cccagtcccgaaaaagggacaaaccaaaccgctccttctaggaaaaagcgtcggtcgcct
gtaccagcagtacccaagtccaagagtccagactccgaggtcagcagtctcatgactaac
gagtctctccccccgtcttcttcaatcgcgtcatctgtttccaagtcagaagcagctgtg
ttggaaggccaggctccagtgctagttgatagcaacccttgctccgctcgcagccctatt
ccagttgccccttcgacagtgctacaaccccacgctggtgtttcactgccctcgttccgg
agtgttttctcgcttccgaaagaaggtgctgcggctccagaagactccactcagcttgac
agtggagttcaacattcagagaagcatacccaatcaaagaaagaagtatctgaacttagt
ggaaagaggcgaaaacgtaaagagaagaagaaggttcctgggaaagctaaaggtgctctt
agcttgctgatgcaatatgatagcgatagtcaaagctccggtggaacacacacagagagt
gatgacagtggctcgggccatagcaccagtcctgtcaatctctcgctaagtcccgtcgtt
gtggaaaccaccgacccttcccggaacctttcttctggtgcgtcgccggtggggaacgag
acctcgggcagcggagttcacatgaatggcgcaggcgctggtctgaaaagcagcgaacca
gtcactcacaagaaacgacccagtgatggtaaaagcccgctggaaaagaaaaagggcaaa
actgtagccgggtctgaacgaacagttggaaatcgaccctcgccttttgtgaacctccac
gacactgtagtgtccatgcagcaattgcaggctgtagctccggtcatgtctatgcccgcg
aattatcagcctttctcttccggatacgcgaattatccacctccaggacaacatggatgt
gtaatgccacgattttctctccagcccagctcgttgagccttacctcaggcgctcgcacg
catgtgcagtataccgctaaccgccctcggggttacccagctgagtctaacacaggtccc
ccaagatatcacgcatcgcctcgtggatacttcccacaatggaggacaagttttgctcca
atgccttgtcagggcccacccttcaaattttcgaacaatggaaataatggtaataacgtg
tttagatag

DBGET integrated database retrieval system