KEGG   Acropora digitifera (stony coral): 107342965Help
Entry
107342965         CDS       T04352                                 

Definition
(RefSeq) fanconi-associated nuclease 1-like
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:adf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107342965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adf03400]
    107342965
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     107342965
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     107342965
DNA repair and recombination proteins [BR:adf03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107342965
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 107342965
NCBI-ProteinID: XP_015763977
LinkDB All DBs
Position
Un
AA seq 354 aa AA seqDB search
MNVIPDDEDTTSNGQAQQLSTLFLANIGKVVYPSYLIDRPTPVLHSRESLIAFTDAFQQK
HEMYMALESNNFELAYGFYPEACKKFNEVLIKLKDNQPEQAVAAAQLPEHLRCFSAEWAI
TKMCYFGVEVMQKWRQYEGAVDQLEKLLEQDVFCFESRGRWYDRLALNLHQHLKRPEKAL
EVIRQGLSDPHVRFGRRLALVQRAKRILSSPAFQKGKKKKCEDFSDLDLKEPSPCKCITI
SGTRCAELGVFIAPEISQDGVVNHDTKTFCAVEEYALSYYRQHGFDQGIHGEGSTFSSLF
CLFMWDIIFTSGIPDVFRSPFQVRLTIVDIRVQSRIMIIVEMTAVKVSVKIKCW
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaattccagatgacgaggatacaacaagcaatggacaagctcaacagctgtca
actttgtttcttgccaacattggcaaagttgtttacccttcatacctgatcgacaggccc
acaccagtgctccattctcgcgaaagcctcattgcgtttacagatgcattccaacaaaag
catgagatgtacatggcactggaaagcaacaactttgagctggcctacggcttttatcct
gaggcgtgtaaaaagtttaatgaggttctcatcaagctgaaagacaaccagccagagcaa
gcagtagcagcggcccaacttcctgagcatttacgctgcttttcagctgagtgggccatc
accaaaatgtgctattttggtgtggaagttatgcagaaatggcggcaatatgaaggagcc
gtagatcagttagagaagctgcttgagcaagatgtattttgctttgaatcccgaggacgt
tggtatgacagactagctctgaatttgcatcaacatttaaaaaggccagaaaaggcttta
gaggtgatcagacaaggtttgtcagatccacatgttcggtttggacgtcgtctggcgctt
gtacaacgagcaaagcgtattctctcttcaccagcctttcaaaaagggaaaaagaaaaag
tgtgaagatttttcagatcttgatttgaaggagccaagtccttgcaagtgtatcacaatc
tctggaacccgttgtgctgaacttggtgtattcattgcccctgaaatcagccaagatggt
gttgtcaatcatgatacgaaaaccttttgtgcggttgaggaatacgctctgtcttattac
cgacaacatggatttgaccaaggaatccatggggagggatctactttctcctctctgttt
tgcttgttcatgtgggacattattttcacgagtggaattccagatgtttttcgcagccca
ttccaggtacgtctcactatagtagacatacgtgtgcagagtagaatcatgattatcgtg
gagatgacagcagtgaaggtgtctgttaagataaagtgttggtaa

DBGET integrated database retrieval system