KEGG   Acropora digitifera (stony coral): 107345186Help
Entry
107345186         CDS       T04352                                 

Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein-like
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00030  Pentose phosphate pathway
adf01100  Metabolic pathways
adf01200  Carbon metabolism
Module
adf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
adf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    107345186
Enzymes [BR:adf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     107345186
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     107345186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C Glucosamine_iso G6PD_N
Motif
Other DBs
NCBI-GeneID: 107345186
NCBI-ProteinID: XP_015766382
LinkDB All DBs
Position
Un
AA seq 699 aa AA seqDB search
MWSFNNVLFFNLFLPSLLKSIILLFRNTVKVQPGERDKGRLFYLSVPPFAYAEIEKRIDS
FCRSKDKQSWTRLVLEKPFGSDLSFARQLAQKLANYFVESEIYRIDHYLSKNGVTQIFNF
RFNNRELLEHLWNXDYIDRVEIVLKERSDCRGRTSFYDHYGVVRDVMQNHMTELLALVAM
EIPNNLDDIAIQQNKLRLLKDTKTLKRWSGVMGQYRQYNAHYNAEKVQDKTTDSQTSNTP
TFAAASIFIDNARWQGIPFILVSGKQLDERAAYVRIVFKENIHRVHSTSFEMTTCSIKQV
VINIQEERFKNPGMLLSGFRSKPKFFQPLHTMMENQTGKLFGCSVKAFYALIQNSSIDAY
TSLISAIYHEKRNFFVGTEDLLASWKIWSQILDSFYGVVPRLYDQESLDVLEFVSVGERL
EFSQDHEGGSCFENGICLSQENFANKNNNYKQELFRGYHMVTGTNLQVIRSLAAKIVDHA
LKAVSLKGTFHLALSGGTSPLMLYETLAFEAKVFPWQHTHIWMVDERCLPLTSQESNFNF
IYEKLLRHVSIPHLNIHPMHVMLKGGLCDPLDQGSGHYEAELQRLVTDQQLDFVVLGAGS
DGHTASLFPHQSAVYNKDNLICLTEGSGSNNVKSRMTMTFNLLNKAKAVAVFVLGERKQD
IVRRLSSGEVDVWNFPVTGIQPETGELIWCIDNEAIGRL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtggtctttcaataatgttctcttctttaacttgtttttgccaagtctcctcaaatca
ataatcctacttttcagaaataccgtaaaagtacaacccggagagagggataaaggacgc
ttattctacttatcagttccaccgtttgcttacgcagaaattgagaaaaggatcgattca
ttttgccgtagcaaagataaacaaagttggactcgtctggttcttgagaaaccctttggt
tccgatctttcatttgctcggcagttagcgcaaaagctggccaattattttgtagaaagc
gaaatctatcgaattgatcactacttgagcaaaaatggagtgacacagatctttaacttt
cgtttcaacaaccgtgagctgctggagcatttgtggaattgagattacatagacagggtg
gaaatagtattgaaggaaaggagtgactgtagaggaagaactagtttttatgatcattat
ggagttgtccgtgatgtcatgcaaaatcacatgacagagctactggcattggttgccatg
gagataccaaacaatctagatgacattgctattcagcaaaacaaattgagacttcttaag
gatactaaaacattgaaaaggtggagtggtgtcatgggccagtacagacaatacaatgcc
cactataatgcagagaaggtgcaagacaagacaactgattctcaaacaagcaacacaccg
acctttgccgctgcatcaatctttattgataatgctcgttggcagggaattcctttcatc
ttggtgtctggaaaacagcttgatgagcgagcagcttatgtgagaattgtattcaaggag
aacattcatagagtgcattcaacttcctttgaaatgaccacatgtagtatcaagcaagta
gtaatcaatattcaagaagagagattcaaaaatccaggaatgcttttatcaggatttcgt
tcaaaacccaaattttttcaaccattgcatacaatgatggagaaccaaacaggaaagctg
tttggttgttcggttaaagcattttatgctctaattcaaaatagctccattgatgcttac
acatctcttatatcagccatctaccacgagaaaagaaatttttttgtcggaaccgaagac
ctattagcttcttggaaaatttggtctcagatcctagacagtttttatggtgttgttcca
cgtctttatgaccaagaaagcttggatgtgttggaatttgtttctgtgggagaacgtctt
gaattttctcaggatcatgagggtggcagttgctttgaaaatggcatttgcttgtcacaa
gagaactttgcaaacaaaaataacaattacaagcaagaattgttcagaggttatcacatg
gtcactggaacaaatttgcaggtaataaggtctcttgcagccaaaattgtagatcatgct
ctgaaagctgtctctctaaaagggacttttcatttggcattatctggggggacgtctcct
ttgatgctctatgagactctggcttttgaggccaaagtgtttccatggcaacacacccac
atttggatggtagatgagcgatgcctaccattaacaagtcaagaatcaaattttaatttc
atatatgaaaaactcttgaggcatgtttccattccacatttaaacatccacccaatgcac
gttatgttaaaaggtggattgtgtgatccacttgaccaaggctctggacactacgaggca
gaacttcagcgattggtcaccgaccagcagttagactttgttgttcttggcgctggttca
gatggacacacggcttccctgtttcctcatcagtcagctgtttataataaagacaatttg
atttgtttaactgagggaagtggttcgaacaatgttaaatcaagaatgacaatgacattt
aacttacttaacaaagccaaggccgtggctgtttttgttctcggtgagcgcaagcaggac
attgtgaggaggctgtcaagcggtgaggttgatgtttggaacttcccggttaccgggatt
caaccggaaactggggagttgatttggtgtattgacaatgaagccattggtcgactctag

DBGET integrated database retrieval system