KEGG   Acropora digitifera (stony coral): 107345198
Entry
107345198         CDS       T04352                                 

Definition
(RefSeq) caspase-3-like
  KO
K02186  caspase 2 [EC:3.4.22.55]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adf01009]
    107345198
   01002 Peptidases and inhibitors [BR:adf01002]
    107345198
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.55  caspase-2
     107345198
Protein phosphatases and associated proteins [BR:adf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107345198
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107345198
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 XS FliH
Other DBs
NCBI-GeneID: 107345198
NCBI-ProteinID: XP_015766400
LinkDB
Position
Un
AA seq 417 aa
MDKKHRELLRRNRERLVEDLEALSLLSYLYQEHTLSENDVDLIKAERTRSSRAEKLLDII
PRRGPQAFHNFCRALERGDGQNHLLALLKTPGSAPQGLVSSTITEFSNNSFVDSADYMSS
VAHHVTAGKSDVATSSAVKNNSKLPQTTEYFIYPMKEQPHGWCLIINNVDFEHHTRRGGS
DIDAKQLKELFTNLQYKVQEHRNQTAEQLKNTVLQFSKMSGHKEADSMVFCLLSHGLEGQ
VYGCDGELVSISDLVAMFNGYEAKDLIGKPKMIFIQACRGVEYDHGADLEVTDDGFLSKS
DKVHITPTNAEILKVAIPNDQAETLVEPETIPAEADMLVAYSTVPGYVSWSHLQKGSWFV
QALVDVFGSYARKEDVVSMLVRVNGKVAKEFESYNRKKQIPAPVVMLTKKVFFFPPS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggataaaaaacatagagaacttttaagaaggaacagggagcgattagtggaagatcta
gaggcattgtcattgttgagttatctctatcaagagcatactttgtccgaaaatgacgtc
gaccttatcaaagctgagaggacaaggtcttcgcgggcagagaaactccttgacattata
ccgaggcgaggaccacaagcgttccacaacttttgtcgggccctagaaagaggagacgga
cagaaccatcttctggctttgttgaaaacacctggatcggctccccaggggttagtgtca
agcacaatcactgaattcagcaacaactcctttgtagactcagctgattacatgagcagt
gttgcacatcatgtaacagctgggaaatctgatgttgcaacttcatctgcagtgaaaaat
aacagcaaattgccacaaaccactgaatacttcatataccccatgaaagaacaacctcat
ggctggtgcctgataatcaataatgttgattttgagcatcacaccagacgtggtggctca
gatatagatgcaaagcagctcaaggaactgtttactaatttacagtacaaggtccaagag
cacagaaatcaaactgcagaacagcttaaaaacactgtgcttcagttttcaaagatgagt
ggccacaaagaagcagattccatggttttctgtcttctcagtcatggccttgaggggcaa
gtttatggctgcgatggtgagttggtgtcaataagcgatctggttgcaatgtttaatgga
tatgaggctaaggatctgattggtaaaccaaagatgattttcatccaagcatgtagagga
gttgaatatgatcatggtgcagacctagaggtgacagacgatggatttctctctaaaagt
gacaaggtacacatcacacccacaaatgctgaaattcttaaggttgctattcccaatgac
caggcagagactttggttgaaccagaaactatccctgctgaagctgacatgctagttgca
tattccacagttcctggttatgtgtcatggagtcatttgcagaaaggctcctggtttgtg
caagctctggttgatgtttttggttcttacgctagaaaagaagatgttgtcagcatgctg
gtgcgagtgaatggaaaagttgccaaagagtttgagtcctacaacaggaaaaaacaaatc
cctgctccggtggtgatgttgacaaagaaagtattcttcttccctccgtcatag

DBGET integrated database retrieval system