KEGG   Acropora digitifera (stony coral): 107345963
Entry
107345963         CDS       T04352                                 

Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1-like
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107345963
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     107345963
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107345963
SSDB
Motif
Pfam: Peptidase_C14 Alpha_adaptinC2 Death MALT1_Ig
Other DBs
NCBI-GeneID: 107345963
NCBI-ProteinID: XP_015767200
LinkDB
Position
Un
AA seq 689 aa
MATVDTVEIERVPTPLRCLKMNVLEELSRKLNPRHNTKDFRYLAGLMNYTYEMVKNLERE
KNPTAYLVSEWAMCHASGGEPKTVGDLLELLKEMRRDDAVEILKPFEFTEVSPKPLNNLN
NGLNKSHDLSGVRPVGLLFGEYASGDLNEKHPAQENEYPCSNSLSSSRIFNDYIGDDERP
HSYQDYLNYVGSPLRSQIPPYHFQNGYSHGEMIRTVQPSHIQQRFTREVPSHPGSRPYQE
VLANIQHTVFHNFGSPLASEPRPPVRSSNLQHGSLNDTMNGAIQPPRVQPRFIPEIPSRP
VVSDKVALVIGNQKYVNKRLQGLVYSEKDAYDMAHALSELEFKVVSLVNLTLAEMRIAVL
MFCRLLAKGCYGVLYYAGHGYEDGGKNYLLPVDSDLKYDRQDSLCAQEILETMQTCDTLL
NVLIIDACRLRMPNNSGSVENGVKRGRLGNNIFAYSCSSQHEAYEEPGQTNGLYALHLLR
HIRRDERIEFILMDVARDVSMASNRNLIQRPCHESDAVFDCRLCDKIAPSNLSGEFMETM
KLWMQAHNLPKKTLPIRQDGIVVSFEYITLFSNVLEVRILATNETPFPRHEVVMDFSVPT
PVKAELAQISGDFLAENGGSLQQRVLLSRLQKQEDPIEVTFKMMYTIDEEVIDWEVQVQL
ECPLVSSVFVKWDWWITCGRLPAQKSTQV
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggcgactgtcgatacggttgagattgaacgcgttccaacacctttgcgttgtttgaaa
atgaatgtcctcgaagaactgtcaaggaaacttaatccgaggcataacacgaaggatttc
agatatctggccggactgatgaattatacctacgaaatggtgaaaaatcttgaacgagaa
aagaatcccacagcctatttggtgagtgagtgggctatgtgtcatgcttcaggcggagag
cccaaaacagttggcgatttattagaattgctgaaagaaatgcggagagatgatgcggtt
gagatcctcaagccgtttgaatttacagaggtaagcccaaagccactgaacaacctaaat
aatgggttaaacaaatcacatgacctatctggcgttcgacctgttgggcttttatttgga
gaatatgctagtggagatttgaatgaaaagcatccagctcaggagaatgagtatccttgt
agtaacagcttgtcatcaagtcgtatttttaacgattacataggagatgatgaaaggccc
cattcataccaagactatcttaattatgttggatcacctcttagatcacaaattccacct
tatcattttcaaaatggttattcacatggtgaaatgataagaacagttcagccttcacat
attcagcaaagatttactcgtgaagttccatctcatccagggtcacgtccttaccaagaa
gttttggctaatattcagcatactgtgtttcataactttggttcacctttggcttcagaa
ccaagaccgccagttcgatcatccaatcttcaacatggatcactaaatgacacaatgaat
ggagccattcaacctccacgtgttcaaccccgttttatcccagaaattccttcacgtcca
gttgtgtcagacaaggttgccttagtgataggaaatcaaaaatatgtaaacaagagactc
cagggactggtttactctgaaaaagatgcttatgatatggcacatgcgctcagtgaactg
gaattcaaggttgtatcacttgtcaacttgactctagcagaaatgagaatagcagtactc
atgttctgtaggttactggccaaaggatgctacggtgttctttactacgctggtcatggc
tacgaagacggaggcaagaactatcttcttccagttgattcagacctcaagtatgatcgg
caagacagcctgtgtgcgcaagagatcctagagacaatgcaaacgtgtgacacattactt
aatgtgctgatcatcgatgcatgccgcttgagaatgcctaataatagtgggtctgtagaa
aacggtgtcaaacgaggacgtttgggcaacaatatttttgcatactcttgttcttctcaa
cacgaagcttatgaggaacctggacaaaccaacgggctttatgcccttcatctcttgaga
cacattagaagagatgagcgtatcgagttcattcttatggatgtcgcacgtgatgtaagc
atggcaagtaatagaaacctcatccagcggccgtgtcatgaatcagatgcggtattcgac
tgtcgactctgtgacaaaatagcgccatctaacttgtcaggcgaatttatggagacaatg
aagctttggatgcaagctcataatcttccaaaaaaaactttgcccatacgccaagatgga
attgtcgtatcattcgaatacattacgctgttttccaatgtcttggaagtcaggatttta
gcaacgaatgaaaccccttttcctcgccatgaggtcgtcatggatttctcagtacctact
ccagtaaaagctgaacttgctcaaatttccggggactttctggcagaaaatggaggaagc
ttacagcagcgtgtactgctgtcgcggttgcaaaagcaagaagaccccattgaggtaaca
ttcaagatgatgtataccatcgatgaagaagtcattgactgggaggtccaagtccagctc
gaatgtcccttggtgtcgtctgtgtttgtgaaatgggattggtggataacttgtggtaga
ttacccgcgcaaaagagcacacaagtttaa

DBGET integrated database retrieval system