KEGG   Acropora digitifera (stony coral): 107346392Help
Entry
107346392         CDS       T04352                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00480  Glutathione metabolism
adf00980  Metabolism of xenobiotics by cytochrome P450
adf00982  Drug metabolism - cytochrome P450
adf00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107346392
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107346392
   00982 Drug metabolism - cytochrome P450
    107346392
   00983 Drug metabolism - other enzymes
    107346392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adf02000]
    107346392
Enzymes [BR:adf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107346392
Transporters [BR:adf02000]
 Other Transporters
  Pores ion channels [TC:1]
   107346392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 107346392
NCBI-ProteinID: XP_015767663
LinkDB All DBs
Position
Un
AA seq 233 aa AA seqDB search
MTHYSKGSEKPPMKGDVLRLYSMRFCPFAQRARLVLAAKGIPYECININLKDKPEWFFEL
NPGGKVPVIEHPNGKVMYESAICCDYLEDFFPDKEPKLYPKDDPFKKYKQRLLVETLGSA
LISAFYKSVLGQEGGQDAIKKPLAEFENNLKQNDKYIGGDKPGMGDYLVWPWFERLEAMQ
PQTLSEFPLTQAWCKAMKELPAVKDCIHTTENHVKFWEKYRAGDADSQLIGVN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacacactattccaaaggatcggagaaaccccccatgaaaggcgatgtacttcgtttg
tacagcatgagattttgtccatttgctcagagagcccggcttgtgctggctgccaaaggc
attccatacgagtgtattaacataaatttaaaggacaagcctgaatggttttttgaattg
aaccctggagggaaagtcccagtgattgaacacccaaatggaaaggtcatgtatgaatca
gcaatttgctgtgactacttggaagattttttccctgacaaagaacctaaactttatccc
aaggatgatccctttaaaaaatacaaacagaggctcttggttgaaacattgggaagtgca
ttaatatcagcattttataagagtgttctggggcaagagggaggccaggatgcaataaag
aaaccgcttgctgaatttgaaaacaacttgaaacagaacgataagtatattggtggggat
aaacctggaatgggagactatcttgtgtggccatggtttgagcgccttgaggcaatgcag
ccccagactttgtccgagtttcctctcactcaggcgtggtgcaaagcaatgaaggaactt
cctgcagtcaaggattgtattcacacaaccgaaaatcatgtgaagttctgggaaaaatac
agagctggtgatgctgattcacagctcattggcgttaattaa

DBGET integrated database retrieval system