KEGG   Acropora digitifera (stony coral): 107348687
Entry
107348687         CDS       T04352                                 

Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1-like
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107348687
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     107348687
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107348687
SSDB
Motif
Pfam: Ig_3 Peptidase_C14 Ig_2 I-set ig V-set Ig_5 Ig_4 Izumo-Ig CHAT Ig_6
Other DBs
NCBI-GeneID: 107348687
NCBI-ProteinID: XP_015770233
LinkDB
Position
Un
AA seq 575 aa
MTEEKFIRDLPDAVKKELAFILDNQRPNWKSLMETIGYGASSITQVGMATLSPGGSPTIA
LLSQLAQDGRTVRELISWLLALPQRSPALQALVNDLRAPVIMQNTPGEVSVLHGQDVCIQ
CEASGSQPLHFQWFKKREELCGKTEKTLILQKVRQEDQGHYVCRVANRFGFCAFSNWTRV
SVSGEQAEDLQCFDFPIITYQSGPVVTTASGSILTLYCDAVGRPAPSFQWYKSNAVIVGA
TVRELTIHNATAEDGAVYFCKVYNSAGEISSEPIEVKVTDVPTNNMRVRGVSVSGPSENE
RVANKVALLMGNKDYQYSQQLGKLFHPINDVCDLTGRLLDMNGFKVVSLVNLTLAEMREA
LRQFCNLLVEETYALFYFAGHGFERHGHSYLMPVDATDKYHPHENMASSEVLKAMQNTKA
KLNVVLLDCCRSEPEPDPDPRMLLQGGDLQDIKEPNVVLAFGCCPQSCVFECPEERNGFF
IKHLLKNMTNEDINKSIEEVLLGVSRGKVNTFVVNNDSMNVGDDDNIDKFFQWSVWWMTG
FESLSLPSDVKCENLKRQRCISNTSNTLTEGCSSQ
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgactgaagaaaaatttatcagggacttacctgatgctgtcaagaaagagctagctttt
atcttggacaaccaacgacctaattggaaatcacttatggagactatcggatatggtgct
tcttccatcacccaggttgggatggcaacactgtcgccagggggaagcccgacgattgcc
ttactcagccaattggctcaagacggcagaactgtgcgggagttaatttcttggctcctt
gctttgccccaaagaagtcctgctcttcaggcacttgttaatgatttaagagcaccagtc
ataatgcagaacacccctggagaggtatcagtgcttcatggacaagatgtttgcatacag
tgtgaagcttctggaagccagcctttgcattttcagtggtttaaaaagagagaggaactt
tgtggaaaaacggaaaaaacattgattctccagaaggtgcgtcaagaagaccaagggcat
tacgtgtgtcgagttgcgaatcgctttgggttttgtgcattcagtaattggacccgagta
agtgtcagtggagaacaagccgaggatctccaatgttttgactttcctatcatcacttac
caatcaggaccagtcgtcaccacggcatcaggctcaatacttacattatattgtgatgct
gttggtagaccagcccctagctttcagtggtataaaagtaatgcagttattgttggagca
acggttagggagctgacgatacacaatgccacagctgaagatggagctgtatatttctgc
aaggtgtataacagtgctggtgaaatctcatctgagccaattgaagtgaaggttacagat
gtaccaacaaacaatatgcgtgttagaggagtctctgtgagtggcccttctgagaatgag
cgagttgcaaacaaggtggctctgttgatgggaaacaaagactaccaatatagtcaacaa
cttggcaaactcttccatcctattaatgatgtctgtgacttgacaggaaggctgctcgat
atgaatggatttaaagtagtttctttggtcaacttgactctagcagaaatgagggaggcc
cttagacagttttgcaatcttcttgtggaagaaacatatgctttgttctactttgctggt
catggatttgagcgtcatggccacagttatctgatgccagtggatgcaacagacaaatac
caccctcatgaaaacatggcttcctcagaagtgctcaaagccatgcaaaacacaaaagca
aagcttaatgttgtcttgctggattgctgcagatcagaaccagagcctgaccctgaccct
agaatgttacttcagggtggtgacttacaagatataaaagaacctaatgtcgtcttggca
tttggatgctgtccacagtcctgtgtgtttgaatgtcctgaagagagaaatggctttttt
atcaagcatcttctgaagaacatgaccaatgaggacataaataaatcaattgaagaggtt
ctgctaggtgttagtcgaggtaaggtcaacacgttcgtagttaacaatgactcaatgaat
gtgggtgatgatgacaacattgataaattctttcagtggtctgtctggtggatgacaggc
ttcgagagtctttcacttccctcagatgtgaagtgtgagaaccttaagcgacaacgatgt
attagtaatactagtaacactctcactgaaggatgttcaagccaatga

DBGET integrated database retrieval system