KEGG   Acropora digitifera (stony coral): 107348694
Entry
107348694         CDS       T04352                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:adf04052]
    107348694
   00536 Glycosaminoglycan binding proteins [BR:adf00536]
    107348694
Cytokines and growth factors [BR:adf04052]
 Growth factors
  Growth factors (RTK binding)
   107348694
Glycosaminoglycan binding proteins [BR:adf00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107348694
SSDB
Motif
Pfam: FGF Fascin ATP-synt_8
Other DBs
NCBI-GeneID: 107348694
NCBI-ProteinID: XP_015770239
LinkDB
Position
Un
AA seq 169 aa
MMYTTIIFLWLTLGLVIFTRTLAFPARSKNSPNTHEVSLHSPNARGFVRIKGSHVDSLAF
TKDDRSAKLQMKSFTVNGSVVVTIQPREKNSYLCVNSDGNLTVETPGNVMSRCLFIEGER
SGYTTFRSHHNRNWYLGFKRNGKVKQPHNTTESQKAARFIIYKTHLTSP
NT seq 510 nt   +upstreamnt  +downstreamnt
atgatgtacacaacgattattttcctctggttaacacttggcttagttattttcacaaga
acattggcatttcccgcgcgaagcaaaaactcgcccaacacgcacgaagtgagtctacac
tcccccaacgcgagaggttttgtaaggataaaaggatcccatgtggatagcctcgccttc
accaaagacgaccgtagtgctaagttacagatgaaatcattcactgtgaatggttccgtt
gtggtcacaatacaacccagggagaaaaacagttacctgtgtgtcaattcggacggtaac
ctaactgtggagactccaggcaatgttatgagccgttgcctattcatcgaaggagagaga
tctggttatacgacatttcgatcacatcacaacaggaactggtatcttggattcaaacgc
aatgggaaagtcaaacagccacacaacacgactgaatcccaaaaagctgcaagatttatc
atttacaagactcacttaacaagtccgtag

DBGET integrated database retrieval system